NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|148833508|ref|NP_060087|]
View 

neurogenic locus notch homolog protein 1 preproprotein [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
JMTM_Notch1 cd21702
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1720-1799 7.60e-49

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 1 (Notch1) and similar proteins; Neurogenic locus notch homolog protein 1 (Notch1), also called translocation-associated notch protein TAN-1, functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. It affects the implementation of differentiation, proliferation and apoptotic programs. It is also involved in angiogenesis, and also negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch1, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


:

Pssm-ID: 411985  Cd Length: 80  Bit Score: 168.43  E-value: 7.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1720 AVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKN 1799
Cdd:cd21702     1 AVKSETVEPPPPSQLYPMYVVLAALVLLAFVGVGVLVSRKRRREHGQLWFPEGFKVSEPSKKKRREPVGEDSVGLKPLKN 80
NOD pfam06816
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1567-1621 2.92e-28

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.


:

Pssm-ID: 399654  Cd Length: 55  Bit Score: 108.74  E-value: 2.92e-28
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 148833508  1567 ERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG 1621
Cdd:pfam06816    1 EKLAEGVLVIVVLMDPEELLNNSVQFLRELSRVLRTNVRFKKDENGNPMIYPWYG 55
NODP pfam07684
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1673-1729 1.32e-24

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.


:

Pssm-ID: 400155  Cd Length: 58  Bit Score: 98.49  E-value: 1.32e-24
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508  1673 GSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPP 1729
Cdd:pfam07684    2 GSVVYLEIDNRKCSQSSDECFSTAQSAADFLAALAAKGGLDLPYPIVSVRSEPPPPP 58
DUF3454 pfam11936
Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. ...
2479-2540 8.48e-23

Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 60 amino acids in length. This domain is found associated with pfam00066, pfam00008, pfam06816, pfam07684, pfam00023.


:

Pssm-ID: 403221  Cd Length: 63  Bit Score: 93.45  E-value: 8.48e-23
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148833508  2479 AQFLTPPSQHSY--SSPVDNTPSHQLQVPEHPFLTPSPESPDQWsSSSPHSNVSDWSEGVSSPP 2540
Cdd:pfam11936    1 EKYPTPPSQHSYssSSGQESTPKHYLHVSEHPYLTPSPESPDQW-SSSSPHSNSDWSDGTPSPT 63
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1932-2025 1.35e-15

Ankyrin repeats (3 copies);


:

Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 74.00  E-value: 1.35e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1932 LHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDarmHDGTTPLILAARLAVEGML 2011
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLK---DNGRTALHYAARSGHLEIV 77
                           90
                   ....*....|....
gi 148833508  2012 EDLINSHADVNAVD 2025
Cdd:pfam12796   78 KLLLEKGADINVKD 91
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1931-2121 1.83e-15

Ankyrin repeat [Signal transduction mechanisms];


:

Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 78.33  E-value: 1.83e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1931 ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATD--LDARMHDGTTPLILAARLAVE 2008
Cdd:COG0666     7 ALLLINKCFLDLLLVALLLLLSLDLSNPSDKKLNLYLELALLPAASLSELLLKLIVDrhLAARDLDGRLPLHSAASKGDD 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2009 GMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV-----LLKNGANKD---MQNNREETPLFLAAREGSYETAKVL 2080
Cdd:COG0666    87 KIVKLLLASGADVNAKDADGDTPLHLAALNGNPPEGNIevaklLLEAGADLDvnnLRDEDGNTPLHWAALNGDADIVELL 166
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 148833508 2081 LDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRS 2121
Cdd:COG0666   167 LEAGADPNSRNSYGVTALDPAAKNGRIELVKLLLDKGLHLS 207
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1873-1982 8.15e-10

Ankyrin repeat [Signal transduction mechanisms];


:

Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 61.38  E-value: 8.15e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPLMIAScsgggletGNSEEEEDAPAVISDFIYQGASLH--NQTDRTGETALHLAARYSRSDAAKRLLEA 1950
Cdd:COG0666    98 DVNAKDADGDTPLHLAA--------LNGNPPEGNIEVAKLLLEAGADLDvnNLRDEDGNTPLHWAALNGDADIVELLLEA 169
                          90       100       110
                  ....*....|....*....|....*....|..
gi 148833508 1951 SADANIQDNMGRTPLHAAVSADAQGVFQILIR 1982
Cdd:COG0666   170 GADPNSRNSYGVTALDPAAKNGRIELVKLLLD 201
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1532-1561 1.20e-08

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


:

Pssm-ID: 395019  Cd Length: 30  Bit Score: 52.53  E-value: 1.20e-08
                           10        20        30
                   ....*....|....*....|....*....|
gi 148833508  1532 YDQYCKDHFSDGHCDQGCNSAECEWDGLDC 1561
Cdd:pfam00066    1 APPYCWDKFGDGVCDEECNNAECLWDGGDC 30
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
869-905 3.31e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.48  E-value: 3.31e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  869 DINECVL-SPCRHGASCQNTHGGYRCHCQAGYSGRNCE 905
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
412-450 3.48e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.10  E-value: 3.48e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  412 DVDECSLGaNPCEHAGKCINTLGSFECQCLQGYTGPRCE 450
Cdd:cd00054     1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1485-1521 4.79e-08

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


:

Pssm-ID: 197463  Cd Length: 38  Bit Score: 50.79  E-value: 4.79e-08
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508   1485 DPWKNCtQSLQCWKYFSDGHCDSQCNSAGCLFDGFDC 1521
Cdd:smart00004    3 DPWSRC-EDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
678-713 8.99e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 8.99e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  678 NIDECA-GNPCHNGGTCEDGINGFTCRCPEGYHDPTC 713
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1021-1057 9.53e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 9.53e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508 1021 DVNECDSQ-PCLHGGTCQDGCGSYRCTCPQGYTGPNCQ 1057
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
528-564 1.02e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.02e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  528 DVDECAST-PCKNGAKCLDGPNTYTCVCTEGYTGTHCE 564
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1184-1219 1.18e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.18e-07
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508 1184 IDECLS-HPCQNGGTCLDLPNTYKCSCPRGTQGVHCE 1219
Cdd:cd00054     2 IDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1442-1479 1.27e-07

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


:

Pssm-ID: 197463  Cd Length: 38  Bit Score: 49.63  E-value: 1.27e-07
                            10        20        30
                    ....*....|....*....|....*....|....*...
gi 148833508   1442 PPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDC 1479
Cdd:smart00004    1 PQDPWSRCEDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
295-332 1.42e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.42e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  295 DVDECQlMPNACQNGGTCHNTHGGYNCVCVNGWTGEDC 332
Cdd:cd00054     1 DIDECA-SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
452-488 1.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  452 DVNECVS-NPCQNDATCLDQIGEFQCICMPGYEGVHCE 488
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
945-981 1.73e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.73e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  945 DINECAS-DPCRNGANCTDCVDSYTCTCPAGFSGIHCE 981
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1146-1180 9.44e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.25  E-value: 9.44e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508 1146 VDEC-SPSPCQNGATCTDYLGGYSCKCVAGYHGVNC 1180
Cdd:cd00054     2 IDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
178-216 1.11e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 46.86  E-value: 1.11e-06
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  178 DVNECgQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCE 216
Cdd:cd00054     1 DIDEC-ASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
791-827 2.94e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 45.71  E-value: 2.94e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  791 NINECAS-NPCLNQGTCIDDVAGYKCNCLLPYTGATCE 827
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
907-943 6.84e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.94  E-value: 6.84e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  907 DIDDCR-PNPCHNGGSCTDGINTAFCDCLPGFRGTFCE 943
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1238-1265 7.26e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.55  E-value: 7.26e-06
                          10        20
                  ....*....|....*....|....*...
gi 148833508 1238 CFNNGTCVDQVGGYSCTCPPGFVGERCE 1265
Cdd:cd00054    11 CQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
755-789 1.02e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.02e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  755 NECES-NPCVNGGTCKDMTSGYVCTCREGFSGPNCQ 789
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
988-1019 1.19e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.19e-05
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508  988 TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ 1019
Cdd:cd00054     7 SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
490-526 2.76e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 2.76e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  490 NTDECAS-SPCLHNGRCLDKINEFQCECPTGFTGHLCQ 526
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
566-601 3.35e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  566 DIDECD-PDPCHY-GSCKDGVATFTCLCRPGYTGHHCE 601
Cdd:cd00054     1 DIDECAsGNPCQNgGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
257-293 3.45e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.62  E-value: 3.45e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  257 NIDDC-PGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT 293
Cdd:cd00054     1 DIDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
603-639 5.12e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 5.12e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  603 NINECSSQ-PCRHGGTCQDRDNAYLCFCLKGTTGPNCE 639
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1267-1305 7.81e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.85  E-value: 7.81e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 148833508 1267 DVNECLS-NPCDARGTqnCVQRVNDFHCECRAGHTGRRCE 1305
Cdd:cd00054     1 DIDECASgNPCQNGGT--CVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
717-750 3.15e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.15e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  717 VNECNS-NPCVHGA-CRDSLNGYKCDCDPGWSGTNC 750
Cdd:cd00054     2 IDECASgNPCQNGGtCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
142-175 3.34e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.34e-04
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 148833508  142 DPCAS-NPCANGGQCLPFEASYICHCPPSFHGPTC 175
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
335-370 6.33e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.16  E-value: 6.33e-04
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  335 NIDDCASAA-CFHGATCHDRVASFYCECPHGRTGLLC 370
Cdd:cd00054     1 DIDECASGNpCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1063-1093 3.18e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


:

Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.98  E-value: 3.18e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1063 CDSSPCKNGGKCWQTHTQYRCECPSGWTGLY 1093
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
223-255 4.67e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.85  E-value: 4.67e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508  223 SPSPCQNGGTCRPTGDvTHECACLPGFTGQNCE 255
Cdd:cd00054     7 SGNPCQNGGTCVNTVG-SYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1315-1346 6.72e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


:

Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.46  E-value: 6.72e-03
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508 1315 PCKNGGTCavaSNTARGFICKCPAGFEGATCE 1346
Cdd:cd00054    10 PCQNGGTC---VNTVGSYRCSCPPGYTGRNCE 38
Atrophin-1 super family cl38111
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
2134-2517 7.52e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


The actual alignment was detected with superfamily member pfam03154:

Pssm-ID: 397323 [Multi-domain]  Cd Length: 982  Bit Score: 41.58  E-value: 7.52e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2134 TLSPPLCSPNGYLGSLKPGVQ-GKKVRKPSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPvDSLESPHGYLSD 2212
Cdd:pfam03154  170 TQPPVLQAQNGVPSPPSAPTAvATDTPTPSAPSLPPQVSPPTTQPPLQPIPSADPHTLIQQTPTLHP-QRLPSPHPPLQP 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2213 VASPPLLPSPFQQSPSVPLNHLPGMPDTHlgighlnvaakpemaalggggrlAFETGPPRLSHLPVASGTSTVLGSSSGG 2292
Cdd:pfam03154  249 MTQPPPPSQVSPQSLPQPGLHGQMPPMPH-----------------------SLQTGPPHLPHPVPPQPFPSSQSQVPPP 305
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2293 ALNFTVGGSTSLNGQCEWLSRLQSGMVPNQY----NPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSyqGL 2368
Cdd:pfam03154  306 PAFQAPGQASQRNHTPPSQSQGPSPQPPREQplppAPLSMPHIKPPPTTPIPQLPNPQSHKHPPHLSAPPFPQMPS--NL 383
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2369 PS-------TRLATQ-------PHL---VQTQQVqpqnlqmqqqnlqpaniqqqqslqpppPPPQPHLGVSSAASGHLGR 2431
Cdd:pfam03154  384 PPppalkplSSLSTHhppsahpPPLqlmPQSQQL---------------------------PSPPAQPPVLTQSQTLPPK 436
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2432 SflSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPvtAAQFLTPPSQH----SYSSPVDNTPS---HQLQV 2504
Cdd:pfam03154  437 S--SYHPPSASHPVPSQSPFPQHSFVPGGPPITPPSGPPPSLSP--SMPGLQPPSSSaasvSSSGPVPAAVScplPPVQI 512
                          410
                   ....*....|....
gi 148833508  2505 PEHPFLTP-SPESP 2517
Cdd:pfam03154  513 KEEPLDEMeEPESP 526
 
Name Accession Description Interval E-value
JMTM_Notch1 cd21702
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1720-1799 7.60e-49

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 1 (Notch1) and similar proteins; Neurogenic locus notch homolog protein 1 (Notch1), also called translocation-associated notch protein TAN-1, functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. It affects the implementation of differentiation, proliferation and apoptotic programs. It is also involved in angiogenesis, and also negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch1, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411985  Cd Length: 80  Bit Score: 168.43  E-value: 7.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1720 AVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKN 1799
Cdd:cd21702     1 AVKSETVEPPPPSQLYPMYVVLAALVLLAFVGVGVLVSRKRRREHGQLWFPEGFKVSEPSKKKRREPVGEDSVGLKPLKN 80
NOD pfam06816
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1567-1621 2.92e-28

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.


Pssm-ID: 399654  Cd Length: 55  Bit Score: 108.74  E-value: 2.92e-28
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 148833508  1567 ERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG 1621
Cdd:pfam06816    1 EKLAEGVLVIVVLMDPEELLNNSVQFLRELSRVLRTNVRFKKDENGNPMIYPWYG 55
NODP pfam07684
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1673-1729 1.32e-24

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.


Pssm-ID: 400155  Cd Length: 58  Bit Score: 98.49  E-value: 1.32e-24
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508  1673 GSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPP 1729
Cdd:pfam07684    2 GSVVYLEIDNRKCSQSSDECFSTAQSAADFLAALAAKGGLDLPYPIVSVRSEPPPPP 58
DUF3454 pfam11936
Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. ...
2479-2540 8.48e-23

Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 60 amino acids in length. This domain is found associated with pfam00066, pfam00008, pfam06816, pfam07684, pfam00023.


Pssm-ID: 403221  Cd Length: 63  Bit Score: 93.45  E-value: 8.48e-23
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148833508  2479 AQFLTPPSQHSY--SSPVDNTPSHQLQVPEHPFLTPSPESPDQWsSSSPHSNVSDWSEGVSSPP 2540
Cdd:pfam11936    1 EKYPTPPSQHSYssSSGQESTPKHYLHVSEHPYLTPSPESPDQW-SSSSPHSNSDWSDGTPSPT 63
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1932-2025 1.35e-15

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 74.00  E-value: 1.35e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1932 LHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDarmHDGTTPLILAARLAVEGML 2011
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLK---DNGRTALHYAARSGHLEIV 77
                           90
                   ....*....|....
gi 148833508  2012 EDLINSHADVNAVD 2025
Cdd:pfam12796   78 KLLLEKGADINVKD 91
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1931-2121 1.83e-15

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 78.33  E-value: 1.83e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1931 ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATD--LDARMHDGTTPLILAARLAVE 2008
Cdd:COG0666     7 ALLLINKCFLDLLLVALLLLLSLDLSNPSDKKLNLYLELALLPAASLSELLLKLIVDrhLAARDLDGRLPLHSAASKGDD 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2009 GMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV-----LLKNGANKD---MQNNREETPLFLAAREGSYETAKVL 2080
Cdd:COG0666    87 KIVKLLLASGADVNAKDADGDTPLHLAALNGNPPEGNIevaklLLEAGADLDvnnLRDEDGNTPLHWAALNGDADIVELL 166
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 148833508 2081 LDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRS 2121
Cdd:COG0666   167 LEAGADPNSRNSYGVTALDPAAKNGRIELVKLLLDKGLHLS 207
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1920-2092 1.48e-13

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 72.55  E-value: 1.48e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1920 LHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQG-----VFQILIRNRA--TDLDARM 1992
Cdd:COG0666    65 HLAARDLDGRLPLHSAASKGDDKIVKLLLASGADVNAKDADGDTPLHLAALNGNPPegnieVAKLLLEAGAdlDVNNLRD 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1993 HDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWaaavnnvdaavvllkngankDMQNNREETPLFLAAREG 2072
Cdd:COG0666   145 EDGNTPLHWAALNGDADIVELLLEAGADPNSRNSYGVTALDP--------------------AAKNGRIELVKLLLDKGL 204
                         170       180
                  ....*....|....*....|
gi 148833508 2073 SYETAKVLLDHFANRDITDH 2092
Cdd:COG0666   205 HLSLLKFNLEGVANANVSKR 224
PHA03095 PHA03095
ankyrin-like protein; Provisional
1873-2081 3.18e-11

ankyrin-like protein; Provisional


Pssm-ID: 222980 [Multi-domain]  Cd Length: 471  Bit Score: 68.51  E-value: 3.18e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPLMIASCsggGLETgnseeeedAPAVISDFIYQGASLhNQTDRTGETALHLAARYSRSDAA--KRLLEA 1950
Cdd:PHA03095  109 DVNAKDKVGRTPLHVYLS---GFNI--------NPKVIRLLLRKGADV-NALDLYGMTPLAVLLKSRNANVEllRLLIDA 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1951 SADANIQDNMGRTPLHA-AVSADA-QGVFQILIRnRATDLDARMHDGTTPLILAARLAV--EGMLEDLINSHADVNAVDD 2026
Cdd:PHA03095  177 GADVYAVDDRFRSLLHHhLQSFKPrARIVRELIR-AGCDPAATDMLGNTPLHSMATGSSckRSLVLPLLIAGISINARNR 255
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148833508 2027 LGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLL 2081
Cdd:PHA03095  256 YGQTPLHYAAVFNNPRACRRLIALGADINAVSSDGNTPLSLMVRNNNGRAVRAAL 310
PHA02878 PHA02878
ankyrin repeat protein; Provisional
1917-2089 3.18e-11

ankyrin repeat protein; Provisional


Pssm-ID: 222939 [Multi-domain]  Cd Length: 477  Bit Score: 68.37  E-value: 3.18e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1917 GASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATdLDARMHDGT 1996
Cdd:PHA02878  157 GADINMKDRHKGNTALHYATENKDQRLTELLLSYGANVNIPDKTNNSPLHHAVKHYNKPIVHILLENGAS-TDARDKCGN 235
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1997 TPL-ILAARLAVEGMLEDLINSHADVNAVDD-LGKSALHwaAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGS- 2073
Cdd:PHA02878  236 TPLhISVGYCKDYDILKLLLEHGVDVNAKSYiLGLTALH--SSIKSERKLKLLLEYGADINSLNSYKLTPLSSAVKQYLc 313
                         170       180
                  ....*....|....*....|.
gi 148833508 2074 YETAKVLLDH-----FANRDI 2089
Cdd:PHA02878  314 INIGRILISNicllkRIKPDI 334
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1999-2091 2.75e-10

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 58.98  E-value: 2.75e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1999 LILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNgANKDMQNNReETPLFLAAREGSYETAK 2078
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEH-ADVNLKDNG-RTALHYAARSGHLEIVK 78
                           90
                   ....*....|...
gi 148833508  2079 VLLDHFANRDITD 2091
Cdd:pfam12796   79 LLLEKGADINVKD 91
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1873-1982 8.15e-10

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 61.38  E-value: 8.15e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPLMIAScsgggletGNSEEEEDAPAVISDFIYQGASLH--NQTDRTGETALHLAARYSRSDAAKRLLEA 1950
Cdd:COG0666    98 DVNAKDADGDTPLHLAA--------LNGNPPEGNIEVAKLLLEAGADLDvnNLRDEDGNTPLHWAALNGDADIVELLLEA 169
                          90       100       110
                  ....*....|....*....|....*....|..
gi 148833508 1951 SADANIQDNMGRTPLHAAVSADAQGVFQILIR 1982
Cdd:COG0666   170 GADPNSRNSYGVTALDPAAKNGRIELVKLLLD 201
TRPV5-6 cd22192
Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and ...
1928-2072 2.07e-09

Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and TRPV6 (TRPV5/6) are two homologous members within the vanilloid subfamily of the transient receptor potential (TRP) family. TRPV5 and TRPV6 show only 30-40% homology with other members of the TRP family and have unique properties that differentiates them from other TRP channels. They mediate calcium uptake in epithelia and their expression is dramatically increased in numerous types of cancer. The structure of TRPV5/6 shows the typical topology features of all TRP family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6, which is predicted to form the Ca2+ pore, and large intracellular N- and C-terminal domains. The N-terminal domain of TRPV5/6 contains three ankyrin repeats. This structural element is present in several proteins and plays a role in protein-protein interactions. The N- and C-terminal tails of TRPV5/6 each contain an internal PDZ motif which can function as part of a molecular scaffold via interaction with PDZ-domain containing proteins. A major difference between the properties of TRPV5 and TRPV6 is in their tissue distribution: TRPV5 is predominantly expressed in the distal convoluted tubules (DCT) and connecting tubules (CNT) of the kidney, with limited expression in extrarenal tissues. In contrast, TRPV6 has a broader expression pattern such as expression in the intestine, kidney, placenta, epididymis, exocrine tissues, and a few other tissues.


Pssm-ID: 411976 [Multi-domain]  Cd Length: 609  Bit Score: 62.72  E-value: 2.07e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1928 GETALHLAARYSRSDAAKRLLEASADAnIQDNM------GRTPLHAAVSADAQGVFQILIRNRATDLDAR---------- 1991
Cdd:cd22192    51 GETALHVAALYDNLEAAVVLMEAAPEL-VNEPMtsdlyqGETALHIAVVNQNLNLVRELIARGADVVSPRatgtffrpgp 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1992 ---MHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV----LLKNGANKD------MQN 2058
Cdd:cd22192   130 knlIYYGEHPLSFAACVGNEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQmydlILSYDKEDDlqpldlVPN 209
                         170
                  ....*....|....
gi 148833508 2059 NREETPLFLAAREG 2072
Cdd:cd22192   210 NQGLTPFKLAAKEG 223
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1532-1561 1.20e-08

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 52.53  E-value: 1.20e-08
                           10        20        30
                   ....*....|....*....|....*....|
gi 148833508  1532 YDQYCKDHFSDGHCDQGCNSAECEWDGLDC 1561
Cdd:pfam00066    1 APPYCWDKFGDGVCDEECNNAECLWDGGDC 30
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
869-905 3.31e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.48  E-value: 3.31e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  869 DINECVL-SPCRHGASCQNTHGGYRCHCQAGYSGRNCE 905
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
412-450 3.48e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.10  E-value: 3.48e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  412 DVDECSLGaNPCEHAGKCINTLGSFECQCLQGYTGPRCE 450
Cdd:cd00054     1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1873-1958 4.56e-08

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 52.81  E-value: 4.56e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1873 DVNVRGPDGFTPLMIAsCSGGGLEtgnseeeedapavISDFIYQGASLHNQTDrtGETALHLAARYSRSDAAKRLLEASA 1952
Cdd:pfam12796   22 DANLQDKNGRTALHLA-AKNGHLE-------------IVKLLLEHADVNLKDN--GRTALHYAARSGHLEIVKLLLEKGA 85

                   ....*.
gi 148833508  1953 DANIQD 1958
Cdd:pfam12796   86 DINVKD 91
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1485-1521 4.79e-08

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 50.79  E-value: 4.79e-08
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508   1485 DPWKNCtQSLQCWKYFSDGHCDSQCNSAGCLFDGFDC 1521
Cdd:smart00004    3 DPWSRC-EDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1493-1521 4.87e-08

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 50.60  E-value: 4.87e-08
                           10        20
                   ....*....|....*....|....*....
gi 148833508  1493 SLQCWKYFSDGHCDSQCNSAGCLFDGFDC 1521
Cdd:pfam00066    2 PPYCWDKFGDGVCDEECNNAECLWDGGDC 30
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1521-1561 8.29e-08

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 50.40  E-value: 8.29e-08
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|.
gi 148833508   1521 CQRAEGQCNplyDQYCKDHFSDGHCDQGCNSAECEWDGLDC 1561
Cdd:smart00004    1 PQDPWSRCE---DAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
869-905 8.69e-08

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 50.32  E-value: 8.69e-08
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    869 DINECVL-SPCRHGASCQNTHGGYRCHCQAGYS-GRNCE 905
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
678-713 8.99e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 8.99e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  678 NIDECA-GNPCHNGGTCEDGINGFTCRCPEGYHDPTC 713
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1021-1057 9.53e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 9.53e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508 1021 DVNECDSQ-PCLHGGTCQDGCGSYRCTCPQGYTGPNCQ 1057
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
528-564 1.02e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.02e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  528 DVDECAST-PCKNGAKCLDGPNTYTCVCTEGYTGTHCE 564
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1184-1219 1.18e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.18e-07
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508 1184 IDECLS-HPCQNGGTCLDLPNTYKCSCPRGTQGVHCE 1219
Cdd:cd00054     2 IDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1442-1479 1.27e-07

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 49.63  E-value: 1.27e-07
                            10        20        30
                    ....*....|....*....|....*....|....*...
gi 148833508   1442 PPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDC 1479
Cdd:smart00004    1 PQDPWSRCEDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
295-332 1.42e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.42e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  295 DVDECQlMPNACQNGGTCHNTHGGYNCVCVNGWTGEDC 332
Cdd:cd00054     1 DIDECA-SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
452-488 1.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  452 DVNECVS-NPCQNDATCLDQIGEFQCICMPGYEGVHCE 488
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
945-981 1.73e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.73e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  945 DINECAS-DPCRNGANCTDCVDSYTCTCPAGFSGIHCE 981
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
412-450 2.76e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 48.78  E-value: 2.76e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 148833508    412 DVDECSLGaNPCEHAGKCINTLGSFECQCLQGYT-GPRCE 450
Cdd:smart00179    1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
678-710 4.29e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 48.40  E-value: 4.29e-07
                            10        20        30
                    ....*....|....*....|....*....|....
gi 148833508    678 NIDECA-GNPCHNGGTCEDGINGFTCRCPEGYHD 710
Cdd:smart00179    1 DIDECAsGNPCQNGGTCVNTVGSYRCECPPGYTD 34
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1146-1180 9.44e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.25  E-value: 9.44e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508 1146 VDEC-SPSPCQNGATCTDYLGGYSCKCVAGYHGVNC 1180
Cdd:cd00054     2 IDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA smart00179
Calcium-binding EGF-like domain;
1183-1219 9.87e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 47.24  E-value: 9.87e-07
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508   1183 EIDECLS-HPCQNGGTCLDLPNTYKCSCPRG-TQGVHCE 1219
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGyTDGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
178-216 1.11e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 46.86  E-value: 1.11e-06
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  178 DVNECgQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCE 216
Cdd:cd00054     1 DIDEC-ASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
945-981 1.26e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.86  E-value: 1.26e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    945 DINECAS-DPCRNGANCTDCVDSYTCTCPAGFS-GIHCE 981
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
1021-1057 1.46e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.86  E-value: 1.46e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508   1021 DVNECDS-QPCLHGGTCQDGCGSYRCTCPQGYT-GPNCQ 1057
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
295-332 2.53e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.09  E-value: 2.53e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    295 DVDECQlMPNACQNGGTCHNTHGGYNCVCVNGWT-GEDC 332
Cdd:smart00179    1 DIDECA-SGNPCQNGGTCVNTVGSYRCECPPGYTdGRNC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
791-827 2.94e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 45.71  E-value: 2.94e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  791 NINECAS-NPCLNQGTCIDDVAGYKCNCLLPYTGATCE 827
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
452-488 3.20e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 3.20e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    452 DVNECVS-NPCQNDATCLDQIGEFQCICMPGYE-GVHCE 488
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
528-564 3.26e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 3.26e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    528 DVDECAST-PCKNGAKCLDGPNTYTCVCTEGYT-GTHCE 564
Cdd:smart00179    1 DIDECASGnPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
907-943 6.84e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.94  E-value: 6.84e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  907 DIDDCR-PNPCHNGGSCTDGINTAFCDCLPGFRGTFCE 943
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1238-1265 7.26e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.55  E-value: 7.26e-06
                          10        20
                  ....*....|....*....|....*...
gi 148833508 1238 CFNNGTCVDQVGGYSCTCPPGFVGERCE 1265
Cdd:cd00054    11 CQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
178-216 7.30e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 44.55  E-value: 7.30e-06
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 148833508    178 DVNECgQKPGLCRHGGTCHNEVGSYRCVCRA-THTGPNCE 216
Cdd:smart00179    1 DIDEC-ASGNPCQNGGTCVNTVGSYRCECPPgYTDGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
755-789 1.02e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.02e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  755 NECES-NPCVNGGTCKDMTSGYVCTCREGFSGPNCQ 789
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
988-1019 1.19e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.19e-05
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508  988 TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ 1019
Cdd:cd00054     7 SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA pfam07645
Calcium-binding EGF domain;
412-445 1.46e-05

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 43.88  E-value: 1.46e-05
                           10        20        30
                   ....*....|....*....|....*....|....
gi 148833508   412 DVDECSLGANPCEHAGKCINTLGSFECQCLQGYT 445
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYE 34
EGF_CA smart00179
Calcium-binding EGF-like domain;
1146-1180 1.82e-05

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.77  E-value: 1.82e-05
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508   1146 VDEC-SPSPCQNGATCTDYLGGYSCKCVAGYH-GVNC 1180
Cdd:smart00179    2 IDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
490-526 2.76e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 2.76e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  490 NTDECAS-SPCLHNGRCLDKINEFQCECPTGFTGHLCQ 526
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1452-1479 2.89e-05

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 42.90  E-value: 2.89e-05
                           10        20
                   ....*....|....*....|....*...
gi 148833508  1452 PECQEDAGNKVCSLQCNNHACGWDGGDC 1479
Cdd:pfam00066    3 PYCWDKFGDGVCDEECNNAECLWDGGDC 30
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
566-601 3.35e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  566 DIDECD-PDPCHY-GSCKDGVATFTCLCRPGYTGHHCE 601
Cdd:cd00054     1 DIDECAsGNPCQNgGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
257-293 3.45e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.62  E-value: 3.45e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  257 NIDDC-PGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT 293
Cdd:cd00054     1 DIDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1025-1055 3.65e-05

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 42.76  E-value: 3.65e-05
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1025 CDSQPCLHGGTCQDGCGSYRCTCPQGYTGPN 1055
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
603-639 5.12e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 5.12e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  603 NINECSSQ-PCRHGGTCQDRDNAYLCFCLKGTTGPNCE 639
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1267-1305 7.81e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.85  E-value: 7.81e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 148833508 1267 DVNECLS-NPCDARGTqnCVQRVNDFHCECRAGHTGRRCE 1305
Cdd:cd00054     1 DIDECASgNPCQNGGT--CVNTVGSYRCSCPPGYTGRNCE 38
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
532-560 1.29e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 41.21  E-value: 1.29e-04
                           10        20
                   ....*....|....*....|....*....
gi 148833508   532 CASTPCKNGAKCLDGPNTYTCVCTEGYTG 560
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
EGF_CA smart00179
Calcium-binding EGF-like domain;
791-827 1.66e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 41.08  E-value: 1.66e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    791 NINECAS-NPCLNQGTCIDDVAGYKCNCLLPYT-GATCE 827
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
682-712 1.88e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 40.44  E-value: 1.88e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   682 CAGNPCHNGGTCEDGINGFTCRCPEGYHDPT 712
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA pfam07645
Calcium-binding EGF domain;
295-328 2.05e-04

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 40.80  E-value: 2.05e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 148833508   295 DVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWT 328
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYE 34
EGF_CA smart00179
Calcium-binding EGF-like domain;
907-943 2.36e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 40.31  E-value: 2.36e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    907 DIDDC-RPNPCHNGGSCTDGINTAFCDCLPGFR-GTFCE 943
Cdd:smart00179    1 DIDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
717-750 3.15e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.15e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  717 VNECNS-NPCVHGA-CRDSLNGYKCDCDPGWSGTNC 750
Cdd:cd00054     2 IDECASgNPCQNGGtCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
142-175 3.34e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.34e-04
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 148833508  142 DPCAS-NPCANGGQCLPFEASYICHCPPSFHGPTC 175
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA smart00179
Calcium-binding EGF-like domain;
603-639 3.40e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.92  E-value: 3.40e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    603 NINECSS-QPCRHGGTCQDRDNAYLCFCLKG-TTGPNCE 639
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGyTDGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
755-789 3.43e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.92  E-value: 3.43e-04
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508    755 NECES-NPCVNGGTCKDMTSGYVCTCREGFS-GPNCQ 789
Cdd:smart00179    3 DECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
490-526 4.79e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 4.79e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    490 NTDECAS-SPCLHNGRCLDKINEFQCECPTGFT-GHLCQ 526
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
1238-1265 4.89e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 4.89e-04
                            10        20
                    ....*....|....*....|....*....
gi 148833508   1238 CFNNGTCVDQVGGYSCTCPPGFV-GERCE 1265
Cdd:smart00179   11 CQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
992-1019 5.03e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 5.03e-04
                            10        20
                    ....*....|....*....|....*....
gi 148833508    992 CFNGGTCVDGINSFTCLCPPGFT-GSYCQ 1019
Cdd:smart00179   11 CQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
494-522 5.58e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 39.29  E-value: 5.58e-04
                           10        20
                   ....*....|....*....|....*....
gi 148833508   494 CASSPCLHNGRCLDKINEFQCECPTGFTG 522
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
335-370 6.33e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.16  E-value: 6.33e-04
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  335 NIDDCASAA-CFHGATCHDRVASFYCECPHGRTGLLC 370
Cdd:cd00054     1 DIDECASGNpCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1149-1179 7.88e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 38.90  E-value: 7.88e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1149 CSPSPCQNGATCTDYLGGYSCKCVAGYHGVN 1179
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
566-601 8.23e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 38.77  E-value: 8.23e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    566 DIDEC-DPDPCHYGS-CKDGVATFTCLCRPGYT-GHHCE 601
Cdd:smart00179    1 DIDECaSGNPCQNGGtCVNTVGSYRCECPPGYTdGRNCE 39
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1187-1217 9.13e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 38.52  E-value: 9.13e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1187 CLSHPCQNGGTCLDLPNTYKCSCPRGTQGVH 1217
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
992-1013 1.51e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 37.70  E-value: 1.51e-03
                           10        20
                   ....*....|....*....|..
gi 148833508   992 CFNGGTCVDGINSFTCLCPPGF 1013
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
261-291 1.76e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 37.75  E-value: 1.76e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   261 CPGNNCKNGGACVDGVNTYNCRCPPEWTGQY 291
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
257-293 2.41e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.61  E-value: 2.41e-03
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    257 NIDDC-PGNNCKNGGACVDGVNTYNCRCPPEWT-GQYCT 293
Cdd:smart00179    1 DIDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
335-364 2.45e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.61  E-value: 2.45e-03
                            10        20        30
                    ....*....|....*....|....*....|.
gi 148833508    335 NIDDCASAA-CFHGATCHDRVASFYCECPHG 364
Cdd:smart00179    1 DIDECASGNpCQNGGTCVNTVGSYRCECPPG 31
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
795-825 2.69e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 37.36  E-value: 2.69e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   795 CASNPCLNQGTCIDDVAGYKCNCLLPYTGAT 825
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
1238-1259 3.07e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 36.93  E-value: 3.07e-03
                           10        20
                   ....*....|....*....|..
gi 148833508  1238 CFNNGTCVDQVGGYSCTCPPGF 1259
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1063-1093 3.18e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.98  E-value: 3.18e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1063 CDSSPCKNGGKCWQTHTQYRCECPSGWTGLY 1093
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA pfam07645
Calcium-binding EGF domain;
178-208 3.35e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 37.33  E-value: 3.35e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   178 DVNECGQKPGLCRHGGTCHNEVGSYRCVCRA 208
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPD 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
716-751 3.43e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.23  E-value: 3.43e-03
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    716 EVNECNS-NPCVHGA-CRDSLNGYKCDCDPGWS-GTNCD 751
Cdd:smart00179    1 DIDECASgNPCQNGGtCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1064-1094 3.87e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.85  E-value: 3.87e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 148833508 1064 DSSPCKNGGKCWQTHTQYRCECPSGWTGLYC 1094
Cdd:cd00054     7 SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
223-255 4.67e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.85  E-value: 4.67e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508  223 SPSPCQNGGTCRPTGDvTHECACLPGFTGQNCE 255
Cdd:cd00054     7 SGNPCQNGGTCVNTVG-SYRCSCPPGYTGRNCE 38
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
911-939 5.36e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.59  E-value: 5.36e-03
                           10        20
                   ....*....|....*....|....*....
gi 148833508   911 CRPNPCHNGGSCTDGINTAFCDCLPGFRG 939
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
144-174 5.36e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.59  E-value: 5.36e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   144 CASNPCANGGQCLPFEASYICHCPPSFHGPT 174
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
1267-1305 6.50e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 36.46  E-value: 6.50e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|.
gi 148833508   1267 DVNECLS-NPCDARGTqnCVQRVNDFHCECRAGHT-GRRCE 1305
Cdd:smart00179    1 DIDECASgNPCQNGGT--CVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1315-1346 6.72e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.46  E-value: 6.72e-03
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508 1315 PCKNGGTCavaSNTARGFICKCPAGFEGATCE 1346
Cdd:cd00054    10 PCQNGGTC---VNTVGSYRCSCPPGYTGRNCE 38
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
2134-2517 7.52e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 397323 [Multi-domain]  Cd Length: 982  Bit Score: 41.58  E-value: 7.52e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2134 TLSPPLCSPNGYLGSLKPGVQ-GKKVRKPSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPvDSLESPHGYLSD 2212
Cdd:pfam03154  170 TQPPVLQAQNGVPSPPSAPTAvATDTPTPSAPSLPPQVSPPTTQPPLQPIPSADPHTLIQQTPTLHP-QRLPSPHPPLQP 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2213 VASPPLLPSPFQQSPSVPLNHLPGMPDTHlgighlnvaakpemaalggggrlAFETGPPRLSHLPVASGTSTVLGSSSGG 2292
Cdd:pfam03154  249 MTQPPPPSQVSPQSLPQPGLHGQMPPMPH-----------------------SLQTGPPHLPHPVPPQPFPSSQSQVPPP 305
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2293 ALNFTVGGSTSLNGQCEWLSRLQSGMVPNQY----NPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSyqGL 2368
Cdd:pfam03154  306 PAFQAPGQASQRNHTPPSQSQGPSPQPPREQplppAPLSMPHIKPPPTTPIPQLPNPQSHKHPPHLSAPPFPQMPS--NL 383
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2369 PS-------TRLATQ-------PHL---VQTQQVqpqnlqmqqqnlqpaniqqqqslqpppPPPQPHLGVSSAASGHLGR 2431
Cdd:pfam03154  384 PPppalkplSSLSTHhppsahpPPLqlmPQSQQL---------------------------PSPPAQPPVLTQSQTLPPK 436
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2432 SflSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPvtAAQFLTPPSQH----SYSSPVDNTPS---HQLQV 2504
Cdd:pfam03154  437 S--SYHPPSASHPVPSQSPFPQHSFVPGGPPITPPSGPPPSLSP--SMPGLQPPSSSaasvSSSGPVPAAVScplPPVQI 512
                          410
                   ....*....|....
gi 148833508  2505 PEHPFLTP-SPESP 2517
Cdd:pfam03154  513 KEEPLDEMeEPESP 526
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
456-486 9.67e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 35.82  E-value: 9.67e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   456 CVSNPCQNDATCLDQIGEFQCICMPGYEGVH 486
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
 
Name Accession Description Interval E-value
JMTM_Notch1 cd21702
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1720-1799 7.60e-49

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 1 (Notch1) and similar proteins; Neurogenic locus notch homolog protein 1 (Notch1), also called translocation-associated notch protein TAN-1, functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. It affects the implementation of differentiation, proliferation and apoptotic programs. It is also involved in angiogenesis, and also negatively regulates endothelial cell proliferation and migration and angiogenic sprouting. This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch1, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411985  Cd Length: 80  Bit Score: 168.43  E-value: 7.60e-49
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1720 AVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKN 1799
Cdd:cd21702     1 AVKSETVEPPPPSQLYPMYVVLAALVLLAFVGVGVLVSRKRRREHGQLWFPEGFKVSEPSKKKRREPVGEDSVGLKPLKN 80
NOD pfam06816
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1567-1621 2.92e-28

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. Role of NOD domain remains to be elucidated.


Pssm-ID: 399654  Cd Length: 55  Bit Score: 108.74  E-value: 2.92e-28
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*
gi 148833508  1567 ERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDAHGQQMIFPYYG 1621
Cdd:pfam06816    1 EKLAEGVLVIVVLMDPEELLNNSVQFLRELSRVLRTNVRFKKDENGNPMIYPWYG 55
JMTM_Notch cd21701
juxtamembrane and transmembrane (JMTM) domain found in Notch protein family; Neurogenic locus ...
1715-1797 3.38e-28

juxtamembrane and transmembrane (JMTM) domain found in Notch protein family; Neurogenic locus notch homolog (Notch) proteins are a family of type-1 transmembrane proteins that form a core component of the Notch signaling pathway. They operate in a variety of different tissues and play a role in a variety of developmental processes by controlling cell fate decisions. The model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch proteins, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411984  Cd Length: 85  Bit Score: 109.78  E-value: 3.38e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1715 PYKIEAVQSET--VEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRKRRRqHGQLWFPEGFKVSEASK-KKRREPLGEDS 1791
Cdd:cd21701     1 PYPIYSVRSEPgpATKTTPPAQLSPLVVAAVCVLLVLVVLGVLVARKRRR-HGTLWFPEGFPRTRASRrSRRRDPVGQDS 79

                  ....*.
gi 148833508 1792 VGLKPL 1797
Cdd:cd21701    80 VGLKNL 85
NODP pfam07684
NOTCH protein; NOTCH signalling plays a fundamental role during a great number of ...
1673-1729 1.32e-24

NOTCH protein; NOTCH signalling plays a fundamental role during a great number of developmental processes in multicellular animals. NOD and NODP represent a region present in many NOTCH proteins and NOTCH homologs in multiple species such as NOTCH2 and NOTCH3, LIN12, SC1 and TAN1. The role of the NOD and NODP domains remains to be elucidated.


Pssm-ID: 400155  Cd Length: 58  Bit Score: 98.49  E-value: 1.32e-24
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508  1673 GSIVYLEIDNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPP 1729
Cdd:pfam07684    2 GSVVYLEIDNRKCSQSSDECFSTAQSAADFLAALAAKGGLDLPYPIVSVRSEPPPPP 58
DUF3454 pfam11936
Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. ...
2479-2540 8.48e-23

Domain of unknown function (DUF3454); This presumed domain is functionally uncharacterized. This domain is found in eukaryotes. This domain is about 60 amino acids in length. This domain is found associated with pfam00066, pfam00008, pfam06816, pfam07684, pfam00023.


Pssm-ID: 403221  Cd Length: 63  Bit Score: 93.45  E-value: 8.48e-23
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 148833508  2479 AQFLTPPSQHSY--SSPVDNTPSHQLQVPEHPFLTPSPESPDQWsSSSPHSNVSDWSEGVSSPP 2540
Cdd:pfam11936    1 EKYPTPPSQHSYssSSGQESTPKHYLHVSEHPYLTPSPESPDQW-SSSSPHSNSDWSDGTPSPT 63
JMTM_Notch2 cd21703
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1714-1797 4.39e-22

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 2 (Notch2) and similar proteins; Neurogenic locus notch homolog protein 2 (Notch2) functions as a receptor for membrane-bound ligands Jagged-1 (JAG1), Jagged-2 (JAG2) and Delta-1 (DLL1) to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. Notch2 is involved in bone remodeling and homeostasis. In collaboration with RELA/p65, it enhances NFATc1 promoter activity and positively regulates RANKL-induced osteoclast differentiation. Notch2 positively regulates self-renewal of liver cancer cells. This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch2, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411986  Cd Length: 82  Bit Score: 92.13  E-value: 4.39e-22
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1714 IPYKIEAVQSEtvePPPPAQLHFMY-VAAAAFVLLFFVGCGVLLSrKRRRQHGQLWFPEGFKVS-EASKKKRREPLGEDS 1791
Cdd:cd21703     1 LPYPLVSVTSE---PLKETKFNLLYlLAVAVAIILLILLLGVLVA-KRKRKHGPLWFPEGFILNkENSNRKRREPVGQDA 76

                  ....*.
gi 148833508 1792 VGLKPL 1797
Cdd:cd21703    77 VGMKNL 82
JMTM_Notch3 cd21704
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1712-1795 8.64e-21

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 3 (Notch3) and similar proteins; Neurogenic locus notch homolog protein 3 (Notch3) functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. The model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch3, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411987  Cd Length: 90  Bit Score: 88.65  E-value: 8.64e-21
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1712 LNIPYKIEAVQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCGVLLSRkRRRQHGQLWFPEGFKV-SEASKKKRREPLGED 1790
Cdd:cd21704     3 LEFPYPIKEVRGEKLEPPPPPVRLLPLLGVAAVILLVILVLGVLVAR-RKREHSTLWFPEGFFLkKESSNKNRREPVGQD 81

                  ....*
gi 148833508 1791 SVGLK 1795
Cdd:cd21704    82 ALGMK 86
JMTM_Notch4 cd21705
juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein ...
1714-1798 1.79e-17

juxtamembrane and transmembrane (JMTM) domain found in neurogenic locus notch homolog protein 4 (Notch4) and similar proteins; Neurogenic locus notch homolog protein 4 (Notch4) functions as a receptor for membrane-bound ligands Jagged1, Jagged2 and Delta1 to regulate cell-fate determination. Upon ligand activation through the released notch intracellular domain (NICD) it forms a transcriptional activator complex with RBPJ/RBPSUH and activates genes of the enhancer of split locus. It affects the implementation of differentiation, proliferation and apoptotic programs. This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of Notch4, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411988  Cd Length: 92  Bit Score: 79.36  E-value: 1.79e-17
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1714 IPYKIEAVQSETVEPPPPAQL-----HFMYVAAAAFVLLFF-VGCGVLLSRKRRRQHGQLWFPEGFKVSEASK-KKRREP 1786
Cdd:cd21705     1 LPFPLLAVTVEEAEKDPQLVAaqlpwPLVCSSVAGVLALVLgALLGVQLIRRRQREHGALWLPPGFARHRDPNpHRRREP 80
                          90
                  ....*....|..
gi 148833508 1787 LGEDSVGLKPLK 1798
Cdd:cd21705    81 VGEDAIGLKPLK 92
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1932-2025 1.35e-15

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 74.00  E-value: 1.35e-15
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1932 LHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDarmHDGTTPLILAARLAVEGML 2011
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLK---DNGRTALHYAARSGHLEIV 77
                           90
                   ....*....|....
gi 148833508  2012 EDLINSHADVNAVD 2025
Cdd:pfam12796   78 KLLLEKGADINVKD 91
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1931-2121 1.83e-15

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 78.33  E-value: 1.83e-15
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1931 ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATD--LDARMHDGTTPLILAARLAVE 2008
Cdd:COG0666     7 ALLLINKCFLDLLLVALLLLLSLDLSNPSDKKLNLYLELALLPAASLSELLLKLIVDrhLAARDLDGRLPLHSAASKGDD 86
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2009 GMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV-----LLKNGANKD---MQNNREETPLFLAAREGSYETAKVL 2080
Cdd:COG0666    87 KIVKLLLASGADVNAKDADGDTPLHLAALNGNPPEGNIevaklLLEAGADLDvnnLRDEDGNTPLHWAALNGDADIVELL 166
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|.
gi 148833508 2081 LDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRS 2121
Cdd:COG0666   167 LEAGADPNSRNSYGVTALDPAAKNGRIELVKLLLDKGLHLS 207
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1920-2092 1.48e-13

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 72.55  E-value: 1.48e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1920 LHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQG-----VFQILIRNRA--TDLDARM 1992
Cdd:COG0666    65 HLAARDLDGRLPLHSAASKGDDKIVKLLLASGADVNAKDADGDTPLHLAALNGNPPegnieVAKLLLEAGAdlDVNNLRD 144
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1993 HDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWaaavnnvdaavvllkngankDMQNNREETPLFLAAREG 2072
Cdd:COG0666   145 EDGNTPLHWAALNGDADIVELLLEAGADPNSRNSYGVTALDP--------------------AAKNGRIELVKLLLDKGL 204
                         170       180
                  ....*....|....*....|
gi 148833508 2073 SYETAKVLLDHFANRDITDH 2092
Cdd:COG0666   205 HLSLLKFNLEGVANANVSKR 224
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1918-2093 3.72e-12

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 68.31  E-value: 3.72e-12
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1918 ASLHNQTDRTGETALHLAARYSRSDAAKrLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRAtDLDARMHDGTT 1997
Cdd:COG0666    31 LSNPSDKKLNLYLELALLPAASLSELLL-KLIVDRHLAARDLDGRLPLHSAASKGDDKIVKLLLASGA-DVNAKDADGDT 108
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1998 PLILAAR---------LAVEGMLEDLINShADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLA 2068
Cdd:COG0666   109 PLHLAALngnppegniEVAKLLLEAGADL-DVNNLRDEDGNTPLHWAALNGDADIVELLLEAGADPNSRNSYGVTALDPA 187
                         170       180
                  ....*....|....*....|....*
gi 148833508 2069 AREGSYETAKVLLDHFANRDITDHM 2093
Cdd:COG0666   188 AKNGRIELVKLLLDKGLHLSLLKFN 212
JMTM_dNotch cd21706
juxtamembrane and transmembrane (JMTM) domain found in Drosophila melanogaster neurogenic ...
1716-1784 1.81e-11

juxtamembrane and transmembrane (JMTM) domain found in Drosophila melanogaster neurogenic locus Notch protein (dNotch) and similar proteins; Drosophila melanogaster neurogenic locus Notch protein (dNotch) is an essential signaling protein which has a major role in many developmental processes. It functions as a receptor for membrane-bound ligands Delta and Serrate to regulate cell-fate determination. It regulates oogenesis, the differentiation of the ectoderm and the development of the central and peripheral nervous system, eye, wing disk, muscles and segmental appendages such as antennae and legs, through lateral inhibition or induction. It also regulates neuroblast self-renewal, identity and proliferation through the regulation of bHLH-O proteins; in larval brains, it is involved in the maintenance of type II neuroblast self-renewal and identity by suppressing erm expression together with pnt. It might also regulate dpn expression through the activation of the transcriptional regulator Su(H). This model corresponds to the juxtamembrane and transmembrane (JMTM) domain of dNotch, which comprises an extended coil, a transmembrane helix (TM), and a beta-strand.


Pssm-ID: 411989  Cd Length: 90  Bit Score: 62.28  E-value: 1.81e-11
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1716 YKIEAVQSETVEPPPPAQlHFMYVAAAAFVLLFFVGC-GVLLSRKRRRQHGQLWFPEGFKVSEASKKKRR 1784
Cdd:cd21706     5 YQVRGEDPPDPPPEPPPS-NLTYVVIGVVVVLLIGLLlGVLVTTQRKRARGITWFPEGFFTTSSSQRRRR 73
PHA03095 PHA03095
ankyrin-like protein; Provisional
1873-2081 3.18e-11

ankyrin-like protein; Provisional


Pssm-ID: 222980 [Multi-domain]  Cd Length: 471  Bit Score: 68.51  E-value: 3.18e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPLMIASCsggGLETgnseeeedAPAVISDFIYQGASLhNQTDRTGETALHLAARYSRSDAA--KRLLEA 1950
Cdd:PHA03095  109 DVNAKDKVGRTPLHVYLS---GFNI--------NPKVIRLLLRKGADV-NALDLYGMTPLAVLLKSRNANVEllRLLIDA 176
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1951 SADANIQDNMGRTPLHA-AVSADA-QGVFQILIRnRATDLDARMHDGTTPLILAARLAV--EGMLEDLINSHADVNAVDD 2026
Cdd:PHA03095  177 GADVYAVDDRFRSLLHHhLQSFKPrARIVRELIR-AGCDPAATDMLGNTPLHSMATGSSckRSLVLPLLIAGISINARNR 255
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 148833508 2027 LGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLL 2081
Cdd:PHA03095  256 YGQTPLHYAAVFNNPRACRRLIALGADINAVSSDGNTPLSLMVRNNNGRAVRAAL 310
PHA02878 PHA02878
ankyrin repeat protein; Provisional
1917-2089 3.18e-11

ankyrin repeat protein; Provisional


Pssm-ID: 222939 [Multi-domain]  Cd Length: 477  Bit Score: 68.37  E-value: 3.18e-11
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1917 GASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATdLDARMHDGT 1996
Cdd:PHA02878  157 GADINMKDRHKGNTALHYATENKDQRLTELLLSYGANVNIPDKTNNSPLHHAVKHYNKPIVHILLENGAS-TDARDKCGN 235
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1997 TPL-ILAARLAVEGMLEDLINSHADVNAVDD-LGKSALHwaAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGS- 2073
Cdd:PHA02878  236 TPLhISVGYCKDYDILKLLLEHGVDVNAKSYiLGLTALH--SSIKSERKLKLLLEYGADINSLNSYKLTPLSSAVKQYLc 313
                         170       180
                  ....*....|....*....|.
gi 148833508 2074 YETAKVLLDH-----FANRDI 2089
Cdd:PHA02878  314 INIGRILISNicllkRIKPDI 334
PHA03095 PHA03095
ankyrin-like protein; Provisional
1873-2033 1.40e-10

ankyrin-like protein; Provisional


Pssm-ID: 222980 [Multi-domain]  Cd Length: 471  Bit Score: 66.20  E-value: 1.40e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPL-MIASCSGggletgnseeeEDAPAVISDFIYQGASLhNQTDRTGETALHLAARYS-RSDAAKRLLEA 1950
Cdd:PHA03095   39 DVNFRGEYGKTPLhLYLHYSS-----------EKVKDIVRLLLEAGADV-NAPERCGFTPLHLYLYNAtTLDVIKLLIKA 106
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1951 SADANIQDNMGRTPLHAAVSADA--QGVFQILIRNRAtDLDARMHDGTTPL---ILAARLAVEgMLEDLINSHADVNAVD 2025
Cdd:PHA03095  107 GADVNAKDKVGRTPLHVYLSGFNinPKVIRLLLRKGA-DVNALDLYGMTPLavlLKSRNANVE-LLRLLIDAGADVYAVD 184

                  ....*...
gi 148833508 2026 DLGKSALH 2033
Cdd:PHA03095  185 DRFRSLLH 192
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1999-2091 2.75e-10

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 58.98  E-value: 2.75e-10
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1999 LILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNgANKDMQNNReETPLFLAAREGSYETAK 2078
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEH-ADVNLKDNG-RTALHYAARSGHLEIVK 78
                           90
                   ....*....|...
gi 148833508  2079 VLLDHFANRDITD 2091
Cdd:pfam12796   79 LLLEKGADINVKD 91
PHA03095 PHA03095
ankyrin-like protein; Provisional
1914-2086 5.01e-10

ankyrin-like protein; Provisional


Pssm-ID: 222980 [Multi-domain]  Cd Length: 471  Bit Score: 64.66  E-value: 5.01e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1914 IYQGASLhNQTDRTGETALHLAARYS---RSDAAKRLLEASADANIQDNMGRTPLHAAV-SADAQGVFQILIRNRAtDLD 1989
Cdd:PHA03095   34 LAAGADV-NFRGEYGKTPLHLYLHYSsekVKDIVRLLLEAGADVNAPERCGFTPLHLYLyNATTLDVIKLLIKAGA-DVN 111
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1990 ARMHDGTTPL--ILAARLAVEGMLEDLINSHADVNAVDDLGKSALHwaaavnnvdaavVLLKN-GANKDMQNnreetpLF 2066
Cdd:PHA03095  112 AKDKVGRTPLhvYLSGFNINPKVIRLLLRKGADVNALDLYGMTPLA------------VLLKSrNANVELLR------LL 173
                         170       180
                  ....*....|....*....|....*
gi 148833508 2067 LAAreGSYETAK-----VLLDHFAN 2086
Cdd:PHA03095  174 IDA--GADVYAVddrfrSLLHHHLQ 196
PHA02875 PHA02875
ankyrin repeat protein; Provisional
1922-2113 7.62e-10

ankyrin repeat protein; Provisional


Pssm-ID: 165206 [Multi-domain]  Cd Length: 413  Bit Score: 63.47  E-value: 7.62e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1922 NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAV-SADAQGVFQILIRNRATDlDARMHDGTTPLI 2000
Cdd:PHA02875   29 NFEIYDGISPIKLAMKFRDSEAIKLLMKHGAIPDVKYPDIESELHDAVeEGDVKAVEELLDLGKFAD-DVFYKDGMTPLH 107
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2001 LAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVL 2080
Cdd:PHA02875  108 LATILKKLDIMKLLIARGADPDIPNTDKFSPLHLAVMMGDIKGIELLIDHKACLDIEDCCGCTPLIIAMAKGDIAICKML 187
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 148833508 2081 LDHFANrdiTDHMDRLPrDI-----AQERMHHDIVRLL 2113
Cdd:PHA02875  188 LDSGAN---IDYFGKNG-CVaalcyAIENNKIDIVRLF 221
ANKYR COG0666
Ankyrin repeat [Signal transduction mechanisms];
1873-1982 8.15e-10

Ankyrin repeat [Signal transduction mechanisms];


Pssm-ID: 223738 [Multi-domain]  Cd Length: 235  Bit Score: 61.38  E-value: 8.15e-10
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1873 DVNVRGPDGFTPLMIAScsgggletGNSEEEEDAPAVISDFIYQGASLH--NQTDRTGETALHLAARYSRSDAAKRLLEA 1950
Cdd:COG0666    98 DVNAKDADGDTPLHLAA--------LNGNPPEGNIEVAKLLLEAGADLDvnNLRDEDGNTPLHWAALNGDADIVELLLEA 169
                          90       100       110
                  ....*....|....*....|....*....|..
gi 148833508 1951 SADANIQDNMGRTPLHAAVSADAQGVFQILIR 1982
Cdd:COG0666   170 GADPNSRNSYGVTALDPAAKNGRIELVKLLLD 201
TRPV5-6 cd22192
Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and ...
1928-2072 2.07e-09

Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and TRPV6 (TRPV5/6) are two homologous members within the vanilloid subfamily of the transient receptor potential (TRP) family. TRPV5 and TRPV6 show only 30-40% homology with other members of the TRP family and have unique properties that differentiates them from other TRP channels. They mediate calcium uptake in epithelia and their expression is dramatically increased in numerous types of cancer. The structure of TRPV5/6 shows the typical topology features of all TRP family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6, which is predicted to form the Ca2+ pore, and large intracellular N- and C-terminal domains. The N-terminal domain of TRPV5/6 contains three ankyrin repeats. This structural element is present in several proteins and plays a role in protein-protein interactions. The N- and C-terminal tails of TRPV5/6 each contain an internal PDZ motif which can function as part of a molecular scaffold via interaction with PDZ-domain containing proteins. A major difference between the properties of TRPV5 and TRPV6 is in their tissue distribution: TRPV5 is predominantly expressed in the distal convoluted tubules (DCT) and connecting tubules (CNT) of the kidney, with limited expression in extrarenal tissues. In contrast, TRPV6 has a broader expression pattern such as expression in the intestine, kidney, placenta, epididymis, exocrine tissues, and a few other tissues.


Pssm-ID: 411976 [Multi-domain]  Cd Length: 609  Bit Score: 62.72  E-value: 2.07e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1928 GETALHLAARYSRSDAAKRLLEASADAnIQDNM------GRTPLHAAVSADAQGVFQILIRNRATDLDAR---------- 1991
Cdd:cd22192    51 GETALHVAALYDNLEAAVVLMEAAPEL-VNEPMtsdlyqGETALHIAVVNQNLNLVRELIARGADVVSPRatgtffrpgp 129
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1992 ---MHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVV----LLKNGANKD------MQN 2058
Cdd:cd22192   130 knlIYYGEHPLSFAACVGNEEIVRLLIEHGADIRAQDSLGNTVLHILVLQPNKTFACQmydlILSYDKEDDlqpldlVPN 209
                         170
                  ....*....|....
gi 148833508 2059 NREETPLFLAAREG 2072
Cdd:cd22192   210 NQGLTPFKLAAKEG 223
PHA03095 PHA03095
ankyrin-like protein; Provisional
1945-2086 2.26e-09

ankyrin-like protein; Provisional


Pssm-ID: 222980 [Multi-domain]  Cd Length: 471  Bit Score: 62.35  E-value: 2.26e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1945 KRLLEASADANIQDNMGRTPLHAAV---SADAQGVFQILIRNRAtDLDARMHDGTTPLILAARLA-VEGMLEDLINSHAD 2020
Cdd:PHA03095   31 RRLLAAGADVNFRGEYGKTPLHLYLhysSEKVKDIVRLLLEAGA-DVNAPERCGFTPLHLYLYNAtTLDVIKLLIKAGAD 109
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2021 VNAVDDLGKSALHWAAAVNNVDAA--VVLLKNGANKDMQNNREETPL--FLAAREGSYETAKVLLDHFAN 2086
Cdd:PHA03095  110 VNAKDKVGRTPLHVYLSGFNINPKviRLLLRKGADVNALDLYGMTPLavLLKSRNANVELLRLLIDAGAD 179
PHA02876 PHA02876
ankyrin repeat protein; Provisional
1922-2116 3.91e-09

ankyrin repeat protein; Provisional


Pssm-ID: 165207 [Multi-domain]  Cd Length: 682  Bit Score: 62.00  E-value: 3.91e-09
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1922 NQTDRTGETALHLAARYS-RSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLI 2000
Cdd:PHA02876  301 NAKNIKGETPLYLMAKNGyDTENIRTLIMLGADVNAADRLYITPLHQASTLDRNKDIVITLLELGANVNARDYCDKTPIH 380
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2001 LAARLAVEGMLEDLINSHADVNAVDDLGKSALHWA-AAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREG-SYETAK 2078
Cdd:PHA02876  381 YAAVRNNVVIINTLLDYGADIEALSQKIGTALHFAlCGTNPYMSVKTLIDRGANVNSKNKDLSTPLHYACKKNcKLDVIE 460
                         170       180       190
                  ....*....|....*....|....*....|....*...
gi 148833508 2079 VLLDHFANRDITDHMDRLPRDIAQErmHHDIVRLLDEY 2116
Cdd:PHA02876  461 MLLDNGADVNAINIQNQYPLLIALE--YHGIVNILLHY 496
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1532-1561 1.20e-08

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 52.53  E-value: 1.20e-08
                           10        20        30
                   ....*....|....*....|....*....|
gi 148833508  1532 YDQYCKDHFSDGHCDQGCNSAECEWDGLDC 1561
Cdd:pfam00066    1 APPYCWDKFGDGVCDEECNNAECLWDGGDC 30
Ank_5 pfam13857
Ankyrin repeats (many copies);
1917-1968 1.34e-08

Ankyrin repeats (many copies);


Pssm-ID: 404699 [Multi-domain]  Cd Length: 56  Bit Score: 53.11  E-value: 1.34e-08
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 148833508  1917 GASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAA 1968
Cdd:pfam13857    5 GPIDLNRLDGEGYTPLHLAAKYGALEIVRVLLAYGVDLNLKDEEGLTALDLA 56
Ank_2 pfam12796
Ankyrin repeats (3 copies);
2047-2113 1.91e-08

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 53.58  E-value: 1.91e-08
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508  2047 LLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLprDIAQERMHHDIVRLL 2113
Cdd:pfam12796   16 LLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLKDNGRTAL--HYAARSGHLEIVKLL 80
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
869-905 3.31e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.48  E-value: 3.31e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  869 DINECVL-SPCRHGASCQNTHGGYRCHCQAGYSGRNCE 905
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
PHA03100 PHA03100
ankyrin repeat protein; Provisional
1932-2113 3.34e-08

ankyrin repeat protein; Provisional


Pssm-ID: 222984 [Multi-domain]  Cd Length: 422  Bit Score: 58.52  E-value: 3.34e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1932 LHLAARYSRSDAAKRLLEASADANIQDNMGRTPLH-----AAVSADAQGVFQILIRNRAtDLDARMHDGTTPLILAARLA 2006
Cdd:PHA03100   39 LYLAKEARNIDVVKILLDNGADINSSTKNNSTPLHylsniKYNLTDVKEIVKLLLEYGA-NVNAPDNNGITPLLYAISKK 117
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2007 VEG--MLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAA------------------VVLLKNGANKDMQNNREETPLF 2066
Cdd:PHA03100  118 SNSysIVEYLLDNGANVNIKNSDGENLLHLYLESNKIDLKilkllidkgvdinaknrvNYLLSYGVPINIKDVYGFTPLH 197
                         170       180       190       200
                  ....*....|....*....|....*....|....*....|....*..
gi 148833508 2067 LAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLL 2113
Cdd:PHA03100  198 YAVYNNNPEFVKYLLDLGANPNLVNKYGDTPLHIAILNNNKEIFKLL 244
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
412-450 3.48e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 51.10  E-value: 3.48e-08
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  412 DVDECSLGaNPCEHAGKCINTLGSFECQCLQGYTGPRCE 450
Cdd:cd00054     1 DIDECASG-NPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
Ank_2 pfam12796
Ankyrin repeats (3 copies);
1873-1958 4.56e-08

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 52.81  E-value: 4.56e-08
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  1873 DVNVRGPDGFTPLMIAsCSGGGLEtgnseeeedapavISDFIYQGASLHNQTDrtGETALHLAARYSRSDAAKRLLEASA 1952
Cdd:pfam12796   22 DANLQDKNGRTALHLA-AKNGHLE-------------IVKLLLEHADVNLKDN--GRTALHYAARSGHLEIVKLLLEKGA 85

                   ....*.
gi 148833508  1953 DANIQD 1958
Cdd:pfam12796   86 DINVKD 91
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1485-1521 4.79e-08

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 50.79  E-value: 4.79e-08
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508   1485 DPWKNCtQSLQCWKYFSDGHCDSQCNSAGCLFDGFDC 1521
Cdd:smart00004    3 DPWSRC-EDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1493-1521 4.87e-08

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 50.60  E-value: 4.87e-08
                           10        20
                   ....*....|....*....|....*....
gi 148833508  1493 SLQCWKYFSDGHCDSQCNSAGCLFDGFDC 1521
Cdd:pfam00066    2 PPYCWDKFGDGVCDEECNNAECLWDGGDC 30
PLN03192 PLN03192
Voltage-dependent potassium channel; Provisional
1924-2062 5.29e-08

Voltage-dependent potassium channel; Provisional


Pssm-ID: 215625 [Multi-domain]  Cd Length: 823  Bit Score: 58.34  E-value: 5.29e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1924 TDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIR-NRATDldarMHDGTTPLILA 2002
Cdd:PLN03192  554 GDSKGRTPLHIAASKGYEDCVLVLLKHACNVHIRDANGNTALWNAISAKHHKIFRILYHfASISD----PHAAGDLLCTA 629
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2003 ARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREE 2062
Cdd:PLN03192  630 AKRNDLTAMKELLKQGLNVDSEDHQGATALQVAMAEDHVDMVRLLIMNGADVDKANTDDD 689
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1521-1561 8.29e-08

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 50.40  E-value: 8.29e-08
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|.
gi 148833508   1521 CQRAEGQCNplyDQYCKDHFSDGHCDQGCNSAECEWDGLDC 1561
Cdd:smart00004    1 PQDPWSRCE---DAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
869-905 8.69e-08

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 50.32  E-value: 8.69e-08
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    869 DINECVL-SPCRHGASCQNTHGGYRCHCQAGYS-GRNCE 905
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
678-713 8.99e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 8.99e-08
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  678 NIDECA-GNPCHNGGTCEDGINGFTCRCPEGYHDPTC 713
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1021-1057 9.53e-08

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 9.53e-08
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508 1021 DVNECDSQ-PCLHGGTCQDGCGSYRCTCPQGYTGPNCQ 1057
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
528-564 1.02e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.02e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  528 DVDECAST-PCKNGAKCLDGPNTYTCVCTEGYTGTHCE 564
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1184-1219 1.18e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.94  E-value: 1.18e-07
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508 1184 IDECLS-HPCQNGGTCLDLPNTYKCSCPRGTQGVHCE 1219
Cdd:cd00054     2 IDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
NL smart00004
Domain found in Notch and Lin-12; The Notch protein is essential for the proper ...
1442-1479 1.27e-07

Domain found in Notch and Lin-12; The Notch protein is essential for the proper differentiation of the Drosophila ectoderm. This protein contains 3 NL domains.


Pssm-ID: 197463  Cd Length: 38  Bit Score: 49.63  E-value: 1.27e-07
                            10        20        30
                    ....*....|....*....|....*....|....*...
gi 148833508   1442 PPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDC 1479
Cdd:smart00004    1 PQDPWSRCEDAQCWDKFGDGVCDEECNNAECLWDGGDC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
295-332 1.42e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.42e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  295 DVDECQlMPNACQNGGTCHNTHGGYNCVCVNGWTGEDC 332
Cdd:cd00054     1 DIDECA-SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
452-488 1.62e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.56  E-value: 1.62e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  452 DVNECVS-NPCQNDATCLDQIGEFQCICMPGYEGVHCE 488
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
945-981 1.73e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 49.17  E-value: 1.73e-07
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  945 DINECAS-DPCRNGANCTDCVDSYTCTCPAGFSGIHCE 981
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
412-450 2.76e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 48.78  E-value: 2.76e-07
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 148833508    412 DVDECSLGaNPCEHAGKCINTLGSFECQCLQGYT-GPRCE 450
Cdd:smart00179    1 DIDECASG-NPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
678-710 4.29e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 48.40  E-value: 4.29e-07
                            10        20        30
                    ....*....|....*....|....*....|....
gi 148833508    678 NIDECA-GNPCHNGGTCEDGINGFTCRCPEGYHD 710
Cdd:smart00179    1 DIDECAsGNPCQNGGTCVNTVGSYRCECPPGYTD 34
JMTM_Notch_APP cd21700
juxtamembrane and transmembrane (JMTM) domain found in Notch and APP family proteins; The ...
1721-1760 4.73e-07

juxtamembrane and transmembrane (JMTM) domain found in Notch and APP family proteins; The substrates of gamma-secretase include amyloid precursor protein (APP) and the Notch receptor. APP, also called APPI, or Alzheimer disease amyloid protein (ABPP), or amyloid precursor protein, or amyloid-beta A4 protein, or cerebral vascular amyloid peptide (CVAP), or PreA4, or protease nexin-II (PN-II), functions as a cell surface receptor and performs physiological functions on the surface of neurons relevant to neurite growth, neuronal adhesion and axonogenesis. Notch proteins are a family of type-1 transmembrane proteins that form a core component of the Notch signaling pathway. They operate in a variety of different tissues and play a role in a variety of developmental processes by controlling cell fate decisions. Successive cleavage of the APP carboxyl-terminal fragment generates amyloid-beta (Abeta) peptides of varying lengths. Accumulation of Abeta peptides such as Abeta42 and Abeta43 leads to formation of amyloid plaques in the brain, a hallmark of Alzheimer's disease. Notch cleavage is involved in cell-fate determination during development and neurogenesis. The model corresponds to the juxtamembrane and transmembrane (JMTM) domain found in Notch and APP family proteins. It comprises a transmembrane helix (TM) with adjacent juxtamembrane (JM) regions. The JMTM domain is likely to be recognized by gamma-secretase in a similar fashion to both Notch and APP family proteins.


Pssm-ID: 411983  Cd Length: 41  Bit Score: 48.16  E-value: 4.73e-07
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|.
gi 148833508 1721 VQSETVEPPPPAQLHFMYVAAAAFVLLFFVGCG-VLLSRKR 1760
Cdd:cd21700     1 LPFFALDDGSGKGAIIGLLVGAVVILLVFVITGgLVAARKK 41
PHA02874 PHA02874
ankyrin repeat protein; Provisional
1922-2110 4.74e-07

ankyrin repeat protein; Provisional


Pssm-ID: 165205 [Multi-domain]  Cd Length: 434  Bit Score: 54.97  E-value: 4.74e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1922 NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATdLDARMHDGTTPLIL 2001
Cdd:PHA02874  118 NIKDAELKTFLHYAIKKGDLESIKMLFEYGADVNIEDDNGCYPIHIAIKHNFFDIIKLLLEKGAY-ANVKDNNGESPLHN 196
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2002 AARLAVEGMLEDLINSHADVNAVDDLGKSALHwaAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAR-EGSYETAKVL 2080
Cdd:PHA02874  197 AAEYGDYACIKLLIDHGNHIMNKCKNGFTPLH--NAIIHNRSAIELLINNASINDQDIDGSTPLHHAINpPCDIDIIDIL 274
                         170       180       190
                  ....*....|....*....|....*....|
gi 148833508 2081 LDHFANRDITDHMDRLPRDIAQERMHHDIV 2110
Cdd:PHA02874  275 LYHKADISIKDNKGENPIDTAFKYINKDPV 304
Ank_4 pfam13637
Ankyrin repeats (many copies);
1930-1981 4.93e-07

Ankyrin repeats (many copies);


Pssm-ID: 372654 [Multi-domain]  Cd Length: 54  Bit Score: 48.42  E-value: 4.93e-07
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|..
gi 148833508  1930 TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILI 1981
Cdd:pfam13637    3 TALHAAAASGHLELLRLLLEKGADINAVDGNGETALHFAASNGNVEVLKLLL 54
PHA02876 PHA02876
ankyrin repeat protein; Provisional
1910-2114 7.93e-07

ankyrin repeat protein; Provisional


Pssm-ID: 165207 [Multi-domain]  Cd Length: 682  Bit Score: 54.68  E-value: 7.93e-07
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1910 ISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATdld 1989
Cdd:PHA02876  160 IAEMLLEGGADVNAKDIYCITPIHYAAERGNAKMVNLLLSYGADVNIIALDDLSVLECAVDSKNIDTIKAIIDNRSN--- 236
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1990 arMHDGTTPLILAAR---LAVEGMLEDlinSHADVNAVDDLGKSALHWAAAVNN-VDAAVVLLKNGANKDMQNNREETPL 2065
Cdd:PHA02876  237 --INKNDLSLLKAIRnedLETSLLLYD---AGFSVNSIDDCKNTPLHHASQAPSlSRLVPKLLERGADVNAKNIKGETPL 311
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|..
gi 148833508 2066 FLAAREG-SYETAKVLLDHFANRDITDHMDRLPRDIAQ--ERMHHDIVRLLD 2114
Cdd:PHA02876  312 YLMAKNGyDTENIRTLIMLGADVNAADRLYITPLHQAStlDRNKDIVITLLE 363
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1146-1180 9.44e-07

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 47.25  E-value: 9.44e-07
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508 1146 VDEC-SPSPCQNGATCTDYLGGYSCKCVAGYHGVNC 1180
Cdd:cd00054     2 IDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA smart00179
Calcium-binding EGF-like domain;
1183-1219 9.87e-07

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 47.24  E-value: 9.87e-07
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508   1183 EIDECLS-HPCQNGGTCLDLPNTYKCSCPRG-TQGVHCE 1219
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGyTDGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
178-216 1.11e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 46.86  E-value: 1.11e-06
                          10        20        30
                  ....*....|....*....|....*....|....*....
gi 148833508  178 DVNECgQKPGLCRHGGTCHNEVGSYRCVCRATHTGPNCE 216
Cdd:cd00054     1 DIDEC-ASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
945-981 1.26e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.86  E-value: 1.26e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    945 DINECAS-DPCRNGANCTDCVDSYTCTCPAGFS-GIHCE 981
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
1021-1057 1.46e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.86  E-value: 1.46e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508   1021 DVNECDS-QPCLHGGTCQDGCGSYRCTCPQGYT-GPNCQ 1057
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
295-332 2.53e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 46.09  E-value: 2.53e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    295 DVDECQlMPNACQNGGTCHNTHGGYNCVCVNGWT-GEDC 332
Cdd:smart00179    1 DIDECA-SGNPCQNGGTCVNTVGSYRCECPPGYTdGRNC 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
791-827 2.94e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 45.71  E-value: 2.94e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  791 NINECAS-NPCLNQGTCIDDVAGYKCNCLLPYTGATCE 827
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
452-488 3.20e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 3.20e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    452 DVNECVS-NPCQNDATCLDQIGEFQCICMPGYE-GVHCE 488
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
528-564 3.26e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 45.70  E-value: 3.26e-06
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    528 DVDECAST-PCKNGAKCLDGPNTYTCVCTEGYT-GTHCE 564
Cdd:smart00179    1 DIDECASGnPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
Ank pfam00023
Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the ...
1928-1959 5.70e-06

Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. Repeats 13-24 are especially active, with known sites of interaction for the Na/K ATPase, Cl/HCO(3) anion exchanger, voltage-gated sodium channel, clathrin heavy chain and L1 family cell adhesion molecules. The ANK repeats are found to form a contiguous spiral stack such that ion transporters like the anion exchanger associate in a large central cavity formed by the ANK repeat spiral, while clathrin and cell adhesion molecules associate with specific regions outside this cavity.


Pssm-ID: 394980 [Multi-domain]  Cd Length: 33  Bit Score: 44.94  E-value: 5.70e-06
                           10        20        30
                   ....*....|....*....|....*....|..
gi 148833508  1928 GETALHLAARYSRSDAAKRLLEASADANIQDN 1959
Cdd:pfam00023    2 GNTPLHLAAREGNLEIVKLLLSKGADVNARDK 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
907-943 6.84e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.94  E-value: 6.84e-06
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  907 DIDDCR-PNPCHNGGSCTDGINTAFCDCLPGFRGTFCE 943
Cdd:cd00054     1 DIDECAsGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
PHA03100 PHA03100
ankyrin repeat protein; Provisional
1922-1986 7.01e-06

ankyrin repeat protein; Provisional


Pssm-ID: 222984 [Multi-domain]  Cd Length: 422  Bit Score: 51.20  E-value: 7.01e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148833508 1922 NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRAT 1986
Cdd:PHA03100  186 NIKDVYGFTPLHYAVYNNNPEFVKYLLDLGANPNLVNKYGDTPLHIAILNNNKEIFKLLLNNGPS 250
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1238-1265 7.26e-06

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.55  E-value: 7.26e-06
                          10        20
                  ....*....|....*....|....*...
gi 148833508 1238 CFNNGTCVDQVGGYSCTCPPGFVGERCE 1265
Cdd:cd00054    11 CQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA smart00179
Calcium-binding EGF-like domain;
178-216 7.30e-06

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 44.55  E-value: 7.30e-06
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|
gi 148833508    178 DVNECgQKPGLCRHGGTCHNEVGSYRCVCRA-THTGPNCE 216
Cdd:smart00179    1 DIDEC-ASGNPCQNGGTCVNTVGSYRCECPPgYTDGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
755-789 1.02e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.02e-05
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  755 NECES-NPCVNGGTCKDMTSGYVCTCREGFSGPNCQ 789
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
988-1019 1.19e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 44.16  E-value: 1.19e-05
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508  988 TESSCFNGGTCVDGINSFTCLCPPGFTGSYCQ 1019
Cdd:cd00054     7 SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA pfam07645
Calcium-binding EGF domain;
412-445 1.46e-05

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 43.88  E-value: 1.46e-05
                           10        20        30
                   ....*....|....*....|....*....|....
gi 148833508   412 DVDECSLGANPCEHAGKCINTLGSFECQCLQGYT 445
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYE 34
EGF_CA smart00179
Calcium-binding EGF-like domain;
1146-1180 1.82e-05

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 43.77  E-value: 1.82e-05
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508   1146 VDEC-SPSPCQNGATCTDYLGGYSCKCVAGYH-GVNC 1180
Cdd:smart00179    2 IDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNC 38
PHA02874 PHA02874
ankyrin repeat protein; Provisional
1942-2086 2.60e-05

ankyrin repeat protein; Provisional


Pssm-ID: 165205 [Multi-domain]  Cd Length: 434  Bit Score: 49.19  E-value: 2.60e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1942 DAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRAtdldarmhdgttplilaarlavegmledlinshaDV 2021
Cdd:PHA02874  105 DMIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGA----------------------------------DV 150
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148833508 2022 NAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFAN 2086
Cdd:PHA02874  151 NIEDDNGCYPIHIAIKHNFFDIIKLLLEKGAYANVKDNNGESPLHNAAEYGDYACIKLLIDHGNH 215
PHA03100 PHA03100
ankyrin repeat protein; Provisional
1914-2095 2.63e-05

ankyrin repeat protein; Provisional


Pssm-ID: 222984 [Multi-domain]  Cd Length: 422  Bit Score: 49.28  E-value: 2.63e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1914 IYQGASLhNQTDRTGETALHLAARYSRS-----DAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQI-LIRNRATD 1987
Cdd:PHA03100   55 LDNGADI-NSSTKNNSTPLHYLSNIKYNltdvkEIVKLLLEYGANVNAPDNNGITPLLYAISKKSNSYSIVeYLLDNGAN 133
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1988 LDARMHDGTTPLilaaRLAVEG------MLEDLINSHADVNA----------------VDDLGKSALHWAAAVNNVDAAV 2045
Cdd:PHA03100  134 VNIKNSDGENLL----HLYLESnkidlkILKLLIDKGVDINAknrvnyllsygvpiniKDVYGFTPLHYAVYNNNPEFVK 209
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|
gi 148833508 2046 VLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANrdiTDHMDR 2095
Cdd:PHA03100  210 YLLDLGANPNLVNKYGDTPLHIAILNNNKEIFKLLLNNGPS---IKTIIE 256
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
490-526 2.76e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 2.76e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  490 NTDECAS-SPCLHNGRCLDKINEFQCECPTGFTGHLCQ 526
Cdd:cd00054     1 DIDECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
Notch pfam00066
LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch ...
1452-1479 2.89e-05

LNR domain; The LNR (Lin-12/Notch repeat) domain is found in three tandem copies in Notch related proteins. The structure of the domain has been determined by NMR and was shown to contain three disulphide bonds and coordinate a calcium ion. Three repeats are also found in the PAPP-A peptidase.


Pssm-ID: 395019  Cd Length: 30  Bit Score: 42.90  E-value: 2.89e-05
                           10        20
                   ....*....|....*....|....*...
gi 148833508  1452 PECQEDAGNKVCSLQCNNHACGWDGGDC 1479
Cdd:pfam00066    3 PYCWDKFGDGVCDEECNNAECLWDGGDC 30
Ank_5 pfam13857
Ankyrin repeats (many copies);
1947-2002 3.04e-05

Ankyrin repeats (many copies);


Pssm-ID: 404699 [Multi-domain]  Cd Length: 56  Bit Score: 43.48  E-value: 3.04e-05
                           10        20        30        40        50
                   ....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508  1947 LLEA-SADANIQDNMGRTPLHAAVSADAQGVFQILIRNRAtDLDARMHDGTTPLILA 2002
Cdd:pfam13857    1 LLEHgPIDLNRLDGEGYTPLHLAAKYGALEIVRVLLAYGV-DLNLKDEEGLTALDLA 56
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
566-601 3.35e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 43.01  E-value: 3.35e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  566 DIDECD-PDPCHY-GSCKDGVATFTCLCRPGYTGHHCE 601
Cdd:cd00054     1 DIDECAsGNPCQNgGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
257-293 3.45e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.62  E-value: 3.45e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  257 NIDDC-PGNNCKNGGACVDGVNTYNCRCPPEWTGQYCT 293
Cdd:cd00054     1 DIDECaSGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1025-1055 3.65e-05

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 42.76  E-value: 3.65e-05
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1025 CDSQPCLHGGTCQDGCGSYRCTCPQGYTGPN 1055
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
603-639 5.12e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 42.24  E-value: 5.12e-05
                          10        20        30
                  ....*....|....*....|....*....|....*...
gi 148833508  603 NINECSSQ-PCRHGGTCQDRDNAYLCFCLKGTTGPNCE 639
Cdd:cd00054     1 DIDECASGnPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38
PHA02874 PHA02874
ankyrin repeat protein; Provisional
1970-2115 5.88e-05

ankyrin repeat protein; Provisional


Pssm-ID: 165205 [Multi-domain]  Cd Length: 434  Bit Score: 48.04  E-value: 5.88e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1970 SADAQGVfQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLK 2049
Cdd:PHA02874   11 SGDIEAI-EKIIKNKGNCINISVDETTTPLIDAIRSGDAKIVELFIKHGADINHINTKIPHPLLTAIKIGAHDIIKLLID 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2050 NGA----------NKDMQN------------NRE-ETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMH 2106
Cdd:PHA02874   90 NGVdtsilpipciEKDMIKtildcgidvnikDAElKTFLHYAIKKGDLESIKMLFEYGADVNIEDDNGCYPIHIAIKHNF 169

                  ....*....
gi 148833508 2107 HDIVRLLDE 2115
Cdd:PHA02874  170 FDIIKLLLE 178
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1267-1305 7.81e-05

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 41.85  E-value: 7.81e-05
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
gi 148833508 1267 DVNECLS-NPCDARGTqnCVQRVNDFHCECRAGHTGRRCE 1305
Cdd:cd00054     1 DIDECASgNPCQNGGT--CVNTVGSYRCSCPPGYTGRNCE 38
TRPV3 cd22194
Transient Receptor Potential channel, Vanilloid subfamily (TRPV), type 3; TRPV3 is a ...
1928-2095 9.20e-05

Transient Receptor Potential channel, Vanilloid subfamily (TRPV), type 3; TRPV3 is a temperature-sensitive Transient Receptor Potential (TRP) ion channel that is activated by warm temperatures, synthetic small-molecule chemicals, and natural compounds from plants. TRPV3 function is regulated by physiological factors such as extracellular divalent cations and acidic pH, intracellular adenosine triphosphate, membrane voltage, and arachidonic acid. It is expressed in both neuronal and non-neuronal tissues including epidermal keratinocytes, epithelial cells in the gut, endothelial cells in blood vessels, and neurons in dorsal root ganglia and CNS. TRPV3 null mice have abnormal hair morphogenesis and compromised skin barrier function. It may play roles in inflammatory skin disorders, such as itch and pain sensation. TRPV3 is also expressed by many neuronal and non-neuronal tissues, showing that TRPV3 might play roles in other unknown cellular and physiological functions. TRPV3 belongs to the vanilloid TRP subfamily (TRPV), named after the founding member vanilloid receptor 1 (TRPV1). The structure of TRPV shows the typical topology features of all TRP ion channel family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6 and large intracellular N- and C-terminal domains.


Pssm-ID: 411978 [Multi-domain]  Cd Length: 680  Bit Score: 47.83  E-value: 9.20e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1928 GETALHLAARYSRSDAAKRLLEASADANIQdnmgrtplhaavsadAQGVFqilirNRATDLDARMHDGTTPLILAA---R 2004
Cdd:cd22194   141 GQTALNIAIERRQGDIVKLLIAKGADVNAH---------------AKGVF-----FNPKYKHEGFYFGETPLALAActnQ 200
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2005 LAVEGMLEDliNSHADVNAVDDLGKSALHWAAAVNNVDAAV---------VLLKNGANKD---MQNNREETPLFLAAREG 2072
Cdd:cd22194   201 PEIVQLLME--KESTDITSQDSRGNTVLHALVTVAEDSKTQndfvkrmydMILLKSENKNletIRNNEGLTPLQLAAKMG 278
                         170       180
                  ....*....|....*....|...
gi 148833508 2073 SYEtakvLLDHFANRDITDHMDR 2095
Cdd:cd22194   279 KAE----ILKYILSREIKEKPNR 297
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
532-560 1.29e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 41.21  E-value: 1.29e-04
                           10        20
                   ....*....|....*....|....*....
gi 148833508   532 CASTPCKNGAKCLDGPNTYTCVCTEGYTG 560
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
TRPV cd21882
Transient Receptor Potential channel, Vanilloid subfamily (TRPV); The vanilloid TRP subfamily ...
1927-2102 1.42e-04

Transient Receptor Potential channel, Vanilloid subfamily (TRPV); The vanilloid TRP subfamily (TRPV), named after the vanilloid receptor 1 (TRPV1), consists of six members: four thermo-sensing channels (TRPV1, TRPV2, TRPV3, and TRPV4) and two Ca2+ selective channels (TRPV5 and TRPV6). The calcium-selective channels TRPV5 and TRPV6 can be heterotetramers and are important for general Ca2+ homeostasis. All four channels within the TRPV1-4 group show temperature-invoked currents when expressed in heterologous cell systems, ranging from activation at ~25C for TRPV4 to ~52C for TRPV2. The structure of TRPV shows the typical topology features of all Transient Receptor Potential (TRP) ion channel family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6 and large intracellular N- and C-terminal domains. The TRP family consists of membrane proteins that function as ion channels that communicate between the cell and its environment, by a vast array of physical or chemical stimuli, including radiation (in the form of temperature, infrared ,or light) and pressure (osmotic or mechanical). TRP channels are formed by a tetrameric complex of channel subunits. Based on sequence identity, the mammalian TRP channel family is classified into six subfamilies, with significant sequence similarity within the transmembrane domains, but very low similarity in their N- and C-terminal cytoplasmic regions. The six subfamilies are named based on their first member: TRPC (canonical), TRPV (vanilloid), TRPM (melastatin), TRPA (ankyrin), TRPML (mucolipin), and TRPP (polycystic).


Pssm-ID: 411975 [Multi-domain]  Cd Length: 600  Bit Score: 47.18  E-value: 1.42e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1927 TGETALHLAARY---SRSDAAKRLLEASADANIQDNM-----------GRTPLHAAVSADAQGVFQILIRNRAtDLDAR- 1991
Cdd:cd21882    25 TGKTCLHKAALNlndGVNEAIMLLLEAAPDSGNPKELvnapctdefyqGQTALHIAIENRNLNLVRLLVENGA-DVSARa 103
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1992 ------------MHDGTTPLILAARLAVEGMLEDLI-NSH--ADVNAVDDLGKSALH---------WAAAVNNVDAAVVL 2047
Cdd:cd21882   104 tgrffrkspgnlFYFGELPLSLAACTNQEEIVRLLLeNGAqpAALEAQDSLGNTVLHalvlqadntPENSAFVCQMYNLL 183
                         170       180       190       200       210       220
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 148833508 2048 LKNGANKD-------MQNNREETPLFLAAREGSYetakVLLDHFANRDITDHMDRLPRDIAQ 2102
Cdd:cd21882   184 LSYGAHLDptqqleeIPNHQGLTPLKLAAVEGKI----VMFQHILQREFSGPYQPLSRKFTE 241
EGF_CA smart00179
Calcium-binding EGF-like domain;
791-827 1.66e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 41.08  E-value: 1.66e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    791 NINECAS-NPCLNQGTCIDDVAGYKCNCLLPYT-GATCE 827
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
682-712 1.88e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 40.44  E-value: 1.88e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   682 CAGNPCHNGGTCEDGINGFTCRCPEGYHDPT 712
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA pfam07645
Calcium-binding EGF domain;
295-328 2.05e-04

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 40.80  E-value: 2.05e-04
                           10        20        30
                   ....*....|....*....|....*....|....
gi 148833508   295 DVDECQLMPNACQNGGTCHNTHGGYNCVCVNGWT 328
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPDGYE 34
TRPV5-6 cd22192
Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and ...
1923-2021 2.14e-04

Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 5 and 6; TRPV5 and TRPV6 (TRPV5/6) are two homologous members within the vanilloid subfamily of the transient receptor potential (TRP) family. TRPV5 and TRPV6 show only 30-40% homology with other members of the TRP family and have unique properties that differentiates them from other TRP channels. They mediate calcium uptake in epithelia and their expression is dramatically increased in numerous types of cancer. The structure of TRPV5/6 shows the typical topology features of all TRP family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6, which is predicted to form the Ca2+ pore, and large intracellular N- and C-terminal domains. The N-terminal domain of TRPV5/6 contains three ankyrin repeats. This structural element is present in several proteins and plays a role in protein-protein interactions. The N- and C-terminal tails of TRPV5/6 each contain an internal PDZ motif which can function as part of a molecular scaffold via interaction with PDZ-domain containing proteins. A major difference between the properties of TRPV5 and TRPV6 is in their tissue distribution: TRPV5 is predominantly expressed in the distal convoluted tubules (DCT) and connecting tubules (CNT) of the kidney, with limited expression in extrarenal tissues. In contrast, TRPV6 has a broader expression pattern such as expression in the intestine, kidney, placenta, epididymis, exocrine tissues, and a few other tissues.


Pssm-ID: 411976 [Multi-domain]  Cd Length: 609  Bit Score: 46.54  E-value: 2.14e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1923 QTDRTGETALHLAARYSRSDAAKRLLE-ASADANIQDNMGRTPLHAAVSADAQGVFQILIRNrATDL-----DARMHDGT 1996
Cdd:cd22192    12 QQKRISESPLLLAAKENDVQAIKKLLKcPSCDLFQRGALGETALHVAALYDNLEAAVVLMEA-APELvnepmTSDLYQGE 90
                          90       100
                  ....*....|....*....|....*
gi 148833508 1997 TPLILAARLAVEGMLEDLINSHADV 2021
Cdd:cd22192    91 TALHIAVVNQNLNLVRELIARGADV 115
EGF_CA smart00179
Calcium-binding EGF-like domain;
907-943 2.36e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 40.31  E-value: 2.36e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    907 DIDDC-RPNPCHNGGSCTDGINTAFCDCLPGFR-GTFCE 943
Cdd:smart00179    1 DIDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
717-750 3.15e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.15e-04
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  717 VNECNS-NPCVHGA-CRDSLNGYKCDCDPGWSGTNC 750
Cdd:cd00054     2 IDECASgNPCQNGGtCVNTVGSYRCSCPPGYTGRNC 37
PTZ00322 PTZ00322
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional
1922-1990 3.27e-04

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional


Pssm-ID: 140343 [Multi-domain]  Cd Length: 664  Bit Score: 46.04  E-value: 3.27e-04
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 148833508 1922 NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDA 1990
Cdd:PTZ00322  109 NCRDYDGRTPLHIACANGHVQVVRVLLEFGADPTLLDKDGKTPLELAEENGFREVVQLLSRHSQCHFEL 177
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
142-175 3.34e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.93  E-value: 3.34e-04
                          10        20        30
                  ....*....|....*....|....*....|....*
gi 148833508  142 DPCAS-NPCANGGQCLPFEASYICHCPPSFHGPTC 175
Cdd:cd00054     3 DECASgNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF_CA smart00179
Calcium-binding EGF-like domain;
603-639 3.40e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.92  E-value: 3.40e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    603 NINECSS-QPCRHGGTCQDRDNAYLCFCLKG-TTGPNCE 639
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGyTDGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
755-789 3.43e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.92  E-value: 3.43e-04
                            10        20        30
                    ....*....|....*....|....*....|....*..
gi 148833508    755 NECES-NPCVNGGTCKDMTSGYVCTCREGFS-GPNCQ 789
Cdd:smart00179    3 DECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
490-526 4.79e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 4.79e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    490 NTDECAS-SPCLHNGRCLDKINEFQCECPTGFT-GHLCQ 526
Cdd:smart00179    1 DIDECASgNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
Ank pfam00023
Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the ...
2062-2092 4.82e-04

Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. Repeats 13-24 are especially active, with known sites of interaction for the Na/K ATPase, Cl/HCO(3) anion exchanger, voltage-gated sodium channel, clathrin heavy chain and L1 family cell adhesion molecules. The ANK repeats are found to form a contiguous spiral stack such that ion transporters like the anion exchanger associate in a large central cavity formed by the ANK repeat spiral, while clathrin and cell adhesion molecules associate with specific regions outside this cavity.


Pssm-ID: 394980 [Multi-domain]  Cd Length: 33  Bit Score: 39.54  E-value: 4.82e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  2062 ETPLFLAAREGSYETAKVLLDHFANRDITDH 2092
Cdd:pfam00023    3 NTPLHLAAREGNLEIVKLLLSKGADVNARDK 33
EGF_CA smart00179
Calcium-binding EGF-like domain;
1238-1265 4.89e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 4.89e-04
                            10        20
                    ....*....|....*....|....*....
gi 148833508   1238 CFNNGTCVDQVGGYSCTCPPGFV-GERCE 1265
Cdd:smart00179   11 CQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA smart00179
Calcium-binding EGF-like domain;
992-1019 5.03e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 39.54  E-value: 5.03e-04
                            10        20
                    ....*....|....*....|....*....
gi 148833508    992 CFNGGTCVDGINSFTCLCPPGFT-GSYCQ 1019
Cdd:smart00179   11 CQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
494-522 5.58e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 39.29  E-value: 5.58e-04
                           10        20
                   ....*....|....*....|....*....
gi 148833508   494 CASSPCLHNGRCLDKINEFQCECPTGFTG 522
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
PHA02878 PHA02878
ankyrin repeat protein; Provisional
1909-2116 5.87e-04

ankyrin repeat protein; Provisional


Pssm-ID: 222939 [Multi-domain]  Cd Length: 477  Bit Score: 44.87  E-value: 5.87e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1909 VISDFIYQGASLhNQTDRTGETALHLAARYSRSDAAKRLLEASadanIQDNMGRT--PLHAAVSADAQGVFQILIRNRAT 1986
Cdd:PHA02878   52 VVKSLLTRGHNV-NQPDHRDLTPLHIICKEPNKLGMKEMIRSI----NKCSVFYTlvAIKDAFNNRNVEIFKIILTNRYK 126
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1987 DLdaRMHDGTTPLILAARLAVEGMLEDLINSH-ADVNAVD-DLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETP 2064
Cdd:PHA02878  127 NI--QTIDLVYIDKKSKDDIIEAEITKLLLSYgADINMKDrHKGNTALHYATENKDQRLTELLLSYGANVNIPDKTNNSP 204
                         170       180       190       200       210
                  ....*....|....*....|....*....|....*....|....*....|...
gi 148833508 2065 LFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQER-MHHDIVRLLDEY 2116
Cdd:PHA02878  205 LHHAVKHYNKPIVHILLENGASTDARDKCGNTPLHISVGYcKDYDILKLLLEH 257
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
335-370 6.33e-04

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 39.16  E-value: 6.33e-04
                          10        20        30
                  ....*....|....*....|....*....|....*..
gi 148833508  335 NIDDCASAA-CFHGATCHDRVASFYCECPHGRTGLLC 370
Cdd:cd00054     1 DIDECASGNpCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
1026-1055 6.97e-04

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 39.00  E-value: 6.97e-04
                          10        20        30
                  ....*....|....*....|....*....|
gi 148833508 1026 DSQPCLHGGTCQDGCGSYRCTCPQGYTGPN 1055
Cdd:cd00053     4 ASNPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1149-1179 7.88e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 38.90  E-value: 7.88e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1149 CSPSPCQNGATCTDYLGGYSCKCVAGYHGVN 1179
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
566-601 8.23e-04

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 38.77  E-value: 8.23e-04
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    566 DIDEC-DPDPCHYGS-CKDGVATFTCLCRPGYT-GHHCE 601
Cdd:smart00179    1 DIDECaSGNPCQNGGtCVNTVGSYRCECPPGYTdGRNCE 39
Ank_2 pfam12796
Ankyrin repeats (3 copies);
2065-2129 8.57e-04

Ankyrin repeats (3 copies);


Pssm-ID: 403870 [Multi-domain]  Cd Length: 91  Bit Score: 40.49  E-value: 8.57e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 148833508  2065 LFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNLVRSPQLHGAPL 2129
Cdd:pfam12796    1 LMLAAKNGNLELVKLLLENGADANLQDKNGRTALHLAAKNGHLEIVKLLLEHADVNLKDNGRTAL 65
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1187-1217 9.13e-04

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 38.52  E-value: 9.13e-04
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1187 CLSHPCQNGGTCLDLPNTYKCSCPRGTQGVH 1217
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
TRPV1-4 cd22193
Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 1-4; TRPV1-4 are ...
1928-2101 9.91e-04

Transient Receptor Potential channel, Vanilloid subfamily (TRPV), types 1-4; TRPV1-4 are thermo-sensing channels that function directly in temperature-sensing and nociception; they share substantial structural and functional properties. Transient Receptor Potential (TRP) ion channels activated by temperature (thermo TRPs) are important molecular players in acute, inflammatory, and chronic pain states. So far, 11 TRP channels in mammalian cells have been identified as thermosensitive TRP (thermo-TRP) channels. TRPV1-4 channels are activated by different heat temperatures, for example, TRPV1 and TRPV2 are activated by high temperatures (>43C and >55C, respectively). TRPV1-4 belong to the vanilloid TRP subfamily (TRPV), named after the founding member vanilloid receptor 1 (TRPV1). The structure of TRPV shows the typical topology features of all TRP ion channel family members, such as six transmembrane regions, a short hydrophobic stretch between transmembrane segments 5 and 6 and large intracellular N- and C-terminal domains.


Pssm-ID: 411977 [Multi-domain]  Cd Length: 607  Bit Score: 44.40  E-value: 9.91e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1928 GETALHLAARYSRSDAAKRLLEASADANIQDN--------------MGRTPLHAAVSADAQGVFQILIRNRATDLDARMH 1993
Cdd:cd22193    76 GQTALHIAIERRQGDIVALLVENGADVHAHAKgrffqpkyqgegfyFGELPLSLAACTNQPDIVQYLLENEHQPADIEAQ 155
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1994 DGTTPLILAARLAVEgmlEDLINSHADVNAVDDLgksalhwaaavnnvdaavvLLKNGAN-------KDMQNNREETPLF 2066
Cdd:cd22193   156 DSRGNTVLHALVTVA---DNTKENTKFVTRMYDM-------------------ILIRGAKlcptvelEEIRNNDGLTPLQ 213
                         170       180       190
                  ....*....|....*....|....*....|....*....
gi 148833508 2067 LAAREGSYEtakvLLDHFANRDITD----HMDRLPRDIA 2101
Cdd:cd22193   214 LAAKMGKIE----ILKYILQREIKEpelrHLSRKFTDWA 248
PTZ00322 PTZ00322
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional
2047-2116 1.47e-03

6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional


Pssm-ID: 140343 [Multi-domain]  Cd Length: 664  Bit Score: 43.73  E-value: 1.47e-03
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2047 LLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEY 2116
Cdd:PTZ00322  101 LLTGGADPNCRDYDGRTPLHIACANGHVQVVRVLLEFGADPTLLDKDGKTPLELAEENGFREVVQLLSRH 170
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
992-1013 1.51e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 37.70  E-value: 1.51e-03
                           10        20
                   ....*....|....*....|..
gi 148833508   992 CFNGGTCVDGINSFTCLCPPGF 1013
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
Ank_3 pfam13606
Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the ...
1928-1956 1.55e-03

Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities.


Pssm-ID: 404492 [Multi-domain]  Cd Length: 30  Bit Score: 38.01  E-value: 1.55e-03
                           10        20
                   ....*....|....*....|....*....
gi 148833508  1928 GETALHLAARYSRSDAAKRLLEASADANI 1956
Cdd:pfam13606    2 GNTPLHLAARNGNLEIVKLLLERGADINA 30
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
987-1017 1.60e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 38.13  E-value: 1.60e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   987 CTESSCFNGGTCVDGINSFTCLCPPGFTGSY 1017
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
261-291 1.76e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 37.75  E-value: 1.76e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   261 CPGNNCKNGGACVDGVNTYNCRCPPEWTGQY 291
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
687-708 1.91e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 37.70  E-value: 1.91e-03
                           10        20
                   ....*....|....*....|..
gi 148833508   687 CHNGGTCEDGINGFTCRCPEGY 708
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
Ank pfam00023
Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the ...
1994-2026 2.10e-03

Ankyrin repeat; Ankyrins are multifunctional adaptors that link specific proteins to the membrane-associated, spectrin- actin cytoskeleton. This repeat-domain is a 'membrane-binding' domain of up to 24 repeated units, and it mediates most of the protein's binding activities. Repeats 13-24 are especially active, with known sites of interaction for the Na/K ATPase, Cl/HCO(3) anion exchanger, voltage-gated sodium channel, clathrin heavy chain and L1 family cell adhesion molecules. The ANK repeats are found to form a contiguous spiral stack such that ion transporters like the anion exchanger associate in a large central cavity formed by the ANK repeat spiral, while clathrin and cell adhesion molecules associate with specific regions outside this cavity.


Pssm-ID: 394980 [Multi-domain]  Cd Length: 33  Bit Score: 37.62  E-value: 2.10e-03
                           10        20        30
                   ....*....|....*....|....*....|...
gi 148833508  1994 DGTTPLILAARLAVEGMLEDLINSHADVNAVDD 2026
Cdd:pfam00023    1 DGNTPLHLAAREGNLEIVKLLLSKGADVNARDK 33
EGF_CA smart00179
Calcium-binding EGF-like domain;
257-293 2.41e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.61  E-value: 2.41e-03
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    257 NIDDC-PGNNCKNGGACVDGVNTYNCRCPPEWT-GQYCT 293
Cdd:smart00179    1 DIDECaSGNPCQNGGTCVNTVGSYRCECPPGYTdGRNCE 39
PHA02946 PHA02946
ankyin-like protein; Provisional
1879-2033 2.45e-03

ankyin-like protein; Provisional


Pssm-ID: 165256 [Multi-domain]  Cd Length: 446  Bit Score: 42.73  E-value: 2.45e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1879 PDGFTPLMIASCSGGGLETGNSEEeedapavisdFIYQGASlHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQD 1958
Cdd:PHA02946   34 PSGNYHILHAYCGIKGLDERFVEE----------LLHRGYS-PNETDDDGNYPLHIASKINNNRIVAMLLTHGADPNACD 102
                          90       100       110       120       130       140       150
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 148833508 1959 NMGRTPLHAAVSADAQGVFQI--LIRNRATDLDARMHDGTTPLiLAARLAVEGMLEDLINSHADVNAVDDLGKSALH 2033
Cdd:PHA02946  103 KQHKTPLYYLSGTDDEVIERInlLVQYGAKINNSVDEEGCGPL-LACTDPSERVFKKIMSIGFEARIVDKFGKNHIH 178
EGF_CA smart00179
Calcium-binding EGF-like domain;
335-364 2.45e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.61  E-value: 2.45e-03
                            10        20        30
                    ....*....|....*....|....*....|.
gi 148833508    335 NIDDCASAA-CFHGATCHDRVASFYCECPHG 364
Cdd:smart00179    1 DIDECASGNpCQNGGTCVNTVGSYRCECPPG 31
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
681-712 2.48e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 37.46  E-value: 2.48e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508  681 ECA-GNPCHNGGTCEDGINGFTCRCPEGYHDPT 712
Cdd:cd00053     1 ECAaSNPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
298-330 2.58e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 37.46  E-value: 2.58e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508  298 ECQLmPNACQNGGTCHNTHGGYNCVCVNGWTGE 330
Cdd:cd00053     1 ECAA-SNPCSNGGTCVNTPGSYRCVCPPGYTGD 32
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
795-825 2.69e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 37.36  E-value: 2.69e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   795 CASNPCLNQGTCIDDVAGYKCNCLLPYTGAT 825
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
1238-1259 3.07e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 36.93  E-value: 3.07e-03
                           10        20
                   ....*....|....*....|..
gi 148833508  1238 CFNNGTCVDQVGGYSCTCPPGF 1259
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
1063-1093 3.18e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.98  E-value: 3.18e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508  1063 CDSSPCKNGGKCWQTHTQYRCECPSGWTGLY 1093
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF_CA pfam07645
Calcium-binding EGF domain;
178-208 3.35e-03

Calcium-binding EGF domain;


Pssm-ID: 311536  Cd Length: 42  Bit Score: 37.33  E-value: 3.35e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   178 DVNECGQKPGLCRHGGTCHNEVGSYRCVCRA 208
Cdd:pfam07645    1 DVDECADGTHNCPANTVCVNTIGSFECVCPD 31
EGF_CA smart00179
Calcium-binding EGF-like domain;
716-751 3.43e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 37.23  E-value: 3.43e-03
                            10        20        30
                    ....*....|....*....|....*....|....*....
gi 148833508    716 EVNECNS-NPCVHGA-CRDSLNGYKCDCDPGWS-GTNCD 751
Cdd:smart00179    1 DIDECASgNPCQNGGtCVNTVGSYRCECPPGYTdGRNCE 39
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1064-1094 3.87e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.85  E-value: 3.87e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 148833508 1064 DSSPCKNGGKCWQTHTQYRCECPSGWTGLYC 1094
Cdd:cd00054     7 SGNPCQNGGTCVNTVGSYRCSCPPGYTGRNC 37
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
1233-1263 4.26e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 37.07  E-value: 4.26e-03
                          10        20        30
                  ....*....|....*....|....*....|.
gi 148833508 1233 SRSPKCFNNGTCVDQVGGYSCTCPPGFVGER 1263
Cdd:cd00053     3 AASNPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
415-448 4.26e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 37.07  E-value: 4.26e-03
                          10        20        30
                  ....*....|....*....|....*....|....
gi 148833508  415 ECSLGaNPCEHAGKCINTLGSFECQCLQGYTGPR 448
Cdd:cd00053     1 ECAAS-NPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
223-255 4.67e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.85  E-value: 4.67e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508  223 SPSPCQNGGTCRPTGDvTHECACLPGFTGQNCE 255
Cdd:cd00054     7 SGNPCQNGGTCVNTVG-SYRCSCPPGYTGRNCE 38
PHA02874 PHA02874
ankyrin repeat protein; Provisional
1930-2113 5.09e-03

ankyrin repeat protein; Provisional


Pssm-ID: 165205 [Multi-domain]  Cd Length: 434  Bit Score: 41.87  E-value: 5.09e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1930 TALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNratdldarmhdGTTPLILAARLAVEG 2009
Cdd:PHA02874   37 TPLIDAIRSGDAKIVELFIKHGADINHINTKIPHPLLTAIKIGAHDIIKLLIDN-----------GVDTSILPIPCIEKD 105
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2010 MLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDI 2089
Cdd:PHA02874  106 MIKTILDCGIDVNIKDAELKTFLHYAIKKGDLESIKMLFEYGADVNIEDDNGCYPIHIAIKHNFFDIIKLLLEKGAYANV 185
                         170       180
                  ....*....|....*....|....
gi 148833508 2090 TDHMDRLPRDIAQERMHHDIVRLL 2113
Cdd:PHA02874  186 KDNNGESPLHNAAEYGDYACIKLL 209
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
911-939 5.36e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.59  E-value: 5.36e-03
                           10        20
                   ....*....|....*....|....*....
gi 148833508   911 CRPNPCHNGGSCTDGINTAFCDCLPGFRG 939
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTG 29
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
144-174 5.36e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.59  E-value: 5.36e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   144 CASNPCANGGQCLPFEASYICHCPPSFHGPT 174
Cdd:pfam00008    1 CAPNPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
421-448 5.41e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 36.59  E-value: 5.41e-03
                           10        20
                   ....*....|....*....|....*...
gi 148833508   421 NPCEHAGKCINTLGSFECQCLQGYTGPR 448
Cdd:pfam00008    4 NPCSNGGTCVDTPGGYTCICPEGYTGKR 31
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
872-905 6.19e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 36.30  E-value: 6.19e-03
                          10        20        30
                  ....*....|....*....|....*....|....*.
gi 148833508  872 ECVLS-PCRHGASCQNTHGGYRCHCQAGYSG-RNCE 905
Cdd:cd00053     1 ECAASnPCSNGGTCVNTPGSYRCVCPPGYTGdRSCE 36
EGF_CA smart00179
Calcium-binding EGF-like domain;
1267-1305 6.50e-03

Calcium-binding EGF-like domain;


Pssm-ID: 214542  Cd Length: 39  Bit Score: 36.46  E-value: 6.50e-03
                            10        20        30        40
                    ....*....|....*....|....*....|....*....|.
gi 148833508   1267 DVNECLS-NPCDARGTqnCVQRVNDFHCECRAGHT-GRRCE 1305
Cdd:smart00179    1 DIDECASgNPCQNGGT--CVNTVGSYRCECPPGYTdGRNCE 39
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
992-1016 6.57e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 36.30  E-value: 6.57e-03
                          10        20
                  ....*....|....*....|....*
gi 148833508  992 CFNGGTCVDGINSFTCLCPPGFTGS 1016
Cdd:cd00053     8 CSNGGTCVNTPGSYRCVCPPGYTGD 32
PHA02917 PHA02917
ankyrin-like protein; Provisional
1922-1970 6.59e-03

ankyrin-like protein; Provisional


Pssm-ID: 165231  Cd Length: 661  Bit Score: 41.91  E-value: 6.59e-03
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|....*....
gi 148833508 1922 NQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVS 1970
Cdd:PHA02917  446 NMIDKRGETLLHKAVRYNKQSLVSLLLESGSDVNIRSNNGYTCIAIAIN 494
PLN03192 PLN03192
Voltage-dependent potassium channel; Provisional
1979-2113 6.63e-03

Voltage-dependent potassium channel; Provisional


Pssm-ID: 215625 [Multi-domain]  Cd Length: 823  Bit Score: 41.78  E-value: 6.63e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1979 ILIRNRATDLDARMhdgTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGAN---KD 2055
Cdd:PLN03192  512 LLGDNGGEHDDPNM---ASNLLTVASTGNAALLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKHACNvhiRD 588
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 2056 MQNN----------------------REETP------LFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHH 2107
Cdd:PLN03192  589 ANGNtalwnaisakhhkifrilyhfaSISDPhaagdlLCTAAKRNDLTAMKELLKQGLNVDSEDHQGATALQVAMAEDHV 668

                  ....*.
gi 148833508 2108 DIVRLL 2113
Cdd:PLN03192  669 DMVRLL 674
EGF_CA cd00054
Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular ...
1315-1346 6.72e-03

Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins. Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements.


Pssm-ID: 238011  Cd Length: 38  Bit Score: 36.46  E-value: 6.72e-03
                          10        20        30
                  ....*....|....*....|....*....|..
gi 148833508 1315 PCKNGGTCavaSNTARGFICKCPAGFEGATCE 1346
Cdd:cd00054    10 PCQNGGTC---VNTVGSYRCSCPPGYTGRNCE 38
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
1188-1219 6.97e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 36.30  E-value: 6.97e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508 1188 LSHPCQNGGTCLDLPNTYKCSCPRGTQGV-HCE 1219
Cdd:cd00053     4 ASNPCSNGGTCVNTPGSYRCVCPPGYTGDrSCE 36
Atrophin-1 pfam03154
Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian ...
2134-2517 7.52e-03

Atrophin-1 family; Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity.


Pssm-ID: 397323 [Multi-domain]  Cd Length: 982  Bit Score: 41.58  E-value: 7.52e-03
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2134 TLSPPLCSPNGYLGSLKPGVQ-GKKVRKPSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPvDSLESPHGYLSD 2212
Cdd:pfam03154  170 TQPPVLQAQNGVPSPPSAPTAvATDTPTPSAPSLPPQVSPPTTQPPLQPIPSADPHTLIQQTPTLHP-QRLPSPHPPLQP 248
                           90       100       110       120       130       140       150       160
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2213 VASPPLLPSPFQQSPSVPLNHLPGMPDTHlgighlnvaakpemaalggggrlAFETGPPRLSHLPVASGTSTVLGSSSGG 2292
Cdd:pfam03154  249 MTQPPPPSQVSPQSLPQPGLHGQMPPMPH-----------------------SLQTGPPHLPHPVPPQPFPSSQSQVPPP 305
                          170       180       190       200       210       220       230       240
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2293 ALNFTVGGSTSLNGQCEWLSRLQSGMVPNQY----NPLRGSVAPGPLSTQAPSLQHGMVGPLHSSLAASALSQMMSyqGL 2368
Cdd:pfam03154  306 PAFQAPGQASQRNHTPPSQSQGPSPQPPREQplppAPLSMPHIKPPPTTPIPQLPNPQSHKHPPHLSAPPFPQMPS--NL 383
                          250       260       270       280       290       300       310       320
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2369 PS-------TRLATQ-------PHL---VQTQQVqpqnlqmqqqnlqpaniqqqqslqpppPPPQPHLGVSSAASGHLGR 2431
Cdd:pfam03154  384 PPppalkplSSLSTHhppsahpPPLqlmPQSQQL---------------------------PSPPAQPPVLTQSQTLPPK 436
                          330       340       350       360       370       380       390       400
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508  2432 SflSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPvtAAQFLTPPSQH----SYSSPVDNTPS---HQLQV 2504
Cdd:pfam03154  437 S--SYHPPSASHPVPSQSPFPQHSFVPGGPPITPPSGPPPSLSP--SMPGLQPPSSSaasvSSSGPVPAAVScplPPVQI 512
                          410
                   ....*....|....
gi 148833508  2505 PEHPFLTP-SPESP 2517
Cdd:pfam03154  513 KEEPLDEMeEPESP 526
EGF cd00053
Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large ...
1148-1179 7.84e-03

Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium.


Pssm-ID: 238010  Cd Length: 36  Bit Score: 36.30  E-value: 7.84e-03
                          10        20        30
                  ....*....|....*....|....*....|...
gi 148833508 1148 ECS-PSPCQNGATCTDYLGGYSCKCVAGYHGVN 1179
Cdd:cd00053     1 ECAaSNPCSNGGTCVNTPGSYRCVCPPGYTGDR 33
PHA02743 PHA02743
Viral ankyrin protein; Provisional
1913-2030 8.74e-03

Viral ankyrin protein; Provisional


Pssm-ID: 222925 [Multi-domain]  Cd Length: 166  Bit Score: 39.41  E-value: 8.74e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148833508 1913 FIYQGASLHNQTDRTGETALHLAARYSRSDAAKR---LLEASADANIQD-NMGRTPLHAAVSADAQGVFQILIRNRATDL 1988
Cdd:PHA02743   42 FISGDGHLLHRYDHHGRQCTHMVAWYDRANAVMKielLVNMGADINARElGTGNTLLHIAASTKNYELAEWLCRQLGVNL 121
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|..
gi 148833508 1989 DARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKS 2030
Cdd:PHA02743  122 GAINYQHETAYHIAYKMRDRRMMEILRANGAVCDDPLSIGLS 163
hEGF pfam12661
Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six ...
306-327 9.57e-03

Human growth factor-like EGF; hEGF, or human growth factor-like EGF, domains have six conserved residues disulfide-bonded into the characteristic 'ababcc' pattern. They are involved in growth and proliferation of cells, in proteins of the Notch/Delta pathway, neurogulin and selectins. hEGFs are also found in mosaic proteins with four-disulfide laminin EGFs such as aggrecan and perlecan. The core fold of the EGF domain consists of two small beta-hairpins packed against each other. Two major structural variants have been identified based on the structural context of the C-terminal Cys residue of disulfide 'c' in the C-terminal hairpin: hEGFs and cEGFs. In hEGFs the C-terminal thiol resides in the beta-turn, resulting in shorter loop-lengths between the Cys residues of disulfide 'c', typically C[8-9]XC. These shorter loop-lengths are also typical of the four-disulfide EGF domains, laminin ad integrin. Tandem hEGF domains have six linking residues between terminal cysteines of adjacent domains. hEGF domains may or may not bind calcium in the linker region. hEGF domains with the consensus motif CXD4X[F,Y]XCXC are hydroxylated exclusively in the Asp residue.


Pssm-ID: 403759  Cd Length: 22  Bit Score: 35.78  E-value: 9.57e-03
                           10        20
                   ....*....|....*....|..
gi 148833508   306 CQNGGTCHNTHGGYNCVCVNGW 327
Cdd:pfam12661    1 CQNGGTCVDLVNGYKCQCPPGY 22
EGF pfam00008
EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very ...
456-486 9.67e-03

EGF-like domain; There is no clear separation between noise and signal. pfam00053 is very similar, but has 8 instead of 6 conserved cysteines. Includes some cytokine receptors. The EGF domain misses the N-terminus regions of the Ca2+ binding EGF domains (this is the main reason of discrepancy between swiss-prot domain start/end and Pfam). The family is hard to model due to many similar but different sub-types of EGF domains. Pfam certainly misses a number of EGF domains.


Pssm-ID: 394967  Cd Length: 31  Bit Score: 35.82  E-value: 9.67e-03
                           10        20        30
                   ....*....|....*....|....*....|.
gi 148833508   456 CVSNPCQNDATCLDQIGEFQCICMPGYEGVH 486
C