NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|6319324|ref|NP_009407.1|]
View 

TPA: gag protein [Saccharomyces cerevisiae S288C]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA super family cl03073
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.20e-55

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


The actual alignment was detected with superfamily member pfam01021:

Pssm-ID: 279373  Cd Length: 98  Bit Score: 180.66  E-value: 5.20e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6319324     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 6319324     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.20e-55

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 180.66  E-value: 5.20e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6319324     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 6319324     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.20e-55

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 180.66  E-value: 5.20e-55
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6319324     17 ACASVTSKEVHTNQDPLDVSASKTEECEKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 6319324     97 NPSGWSFYGHPSMIPYTP 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
PAT1 pfam09770
Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate ...
41-141 4.46e-04

Topoisomerase II-associated protein PAT1; Members of this family are necessary for accurate chromosome transmission during cell division.


Pssm-ID: 313063  Cd Length: 837  Bit Score: 42.30  E-value: 4.46e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6319324     41 EECEkASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYPQQCMMTQNQANPSGWSFYGHPSMI----PYTPYQ 116
Cdd:pfam09770 192 EEVE-AAMRAQAKKPAQQPAPAPPQQPQAPPAQQQQQQQQFPPQQQQQQQPQQQPQQPQQHPGQGHPVTIlqrpQSKQPD 270
                          90       100
                  ....*....|....*....|....*
gi 6319324    117 MSPMYFPPGPQSQFPQYPSSVGTPL 141
Cdd:pfam09770 271 PPQPSPQPQAQPFHQQPPPVPVQPT 295
Cytadhesin_P30 pfam07271
Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 ...
33-149 1.96e-03

Cytadhesin P30/P32; This family consists of several Mycoplasma species specific Cytadhesin P32 and P30 proteins. P30 has been found to be membrane associated and localized on the tip organelle. It is thought that it is important in cytadherence and virulence.


Pssm-ID: 284643  Cd Length: 308  Bit Score: 39.83  E-value: 1.96e-03
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 6319324     33 LDVSASKTEECEK-ASTKANSQQTTTPASSAVPENPHHASPQTaqSHSPQNGPYPQQCMMTQNQANPSGWSFYG------ 105
Cdd:pfam07271 124 IEAEQEEQEAIEQqAAAEAHAEAETEPAGQNVANNPQMGINQP--QININFGPNPQQRINPQCFGFPMQPGQMAmrpgfn 201
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
gi 6319324    106 ----HPSMIPYTPYQMSPMY--FPP-----GPQSQFPQYPSSVGTPLSTPSPESG 149
Cdd:pfam07271 202 qmppHMGGAPPNQMGMRPGFnqMPPqmggmAPRPGFPNHMPGMNAPRPGFPPQPG 256
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH