NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4826784|ref|NP_004966|]
View 

potassium voltage-gated channel subfamily B member 1 [Homo sapiens]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
BTB_POZ_KCNB2 cd18412
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
15-141 2.30e-84

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily B member 2 (KCNB2); KCNB2, also called voltage-gated potassium channel subunit Kv2.2, mediates transmembrane potassium transport in excitable membranes, primarily in the brain and smooth muscle cells. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNB2 contributes to the delayed-rectifier voltage-gated potassium current in cortical pyramidal neurons and smooth muscle cells. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNB2 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


:

Pssm-ID: 349719  Cd Length: 127  Bit Score: 264.95  E-value: 2.30e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   15 SLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTS 94
Cdd:cd18412   1 SLPPEPVEIIRSKACSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTS 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 4826784   95 ILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKK 141
Cdd:cd18412  81 ILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKK 127
Kv2channel super family cl04131
Kv2 voltage-gated K+ channel;
467-679 1.69e-62

Kv2 voltage-gated K+ channel;


The actual alignment was detected with superfamily member pfam03521:

Pssm-ID: 308887  Cd Length: 288  Bit Score: 212.46  E-value: 1.69e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    467 KNGENMGKKDKVQDNHLSPNKWKWTKRTLSETSSSKSFETK-----EQGSPEKA-RSSSSPQHLNVQQLEDMYNKMAKTQ 540
Cdd:pfam03521   1 KSGEGANKKESPDDNHLSPSRWKWSRRTLSETSSNKSYENKyqevsQQDSHEQLnNASSSPQHLSAQKLEELYNEITKTQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    541 SQPILNT--KESAAQS-KPKEELEMESIPSPVAPLPT-RTEGVIDMRSMSSIDSFISCATDFPEATRfshSPLTSLPS-- 614
Cdd:pfam03521  81 SHPSLNSsyQEQAEKPpAYEEEIEMEEVPCPQDQLLVaQTDAVTDMRSTSSIDSFASCATDFTETER---SPLPPYIGsh 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    615 ---------------KTGGSTAPEVGWRGALGASGGRFVEANP-----SPDASQ---------HSSFFIESPKSSMKTNN 665
Cdd:pfam03521 158 lqmrfpsdstpleehQRARSSQFLTLTKDKGFAPKDVTFEYTPidrtmNSDNSGsqsplqghlQFDSAVESPKSSLKGNN 237
                         250
                  ....*....|....
gi 4826784    666 PLKLRALKVNFMEG 679
Cdd:pfam03521 238 PLKSRSLKVNFKEN 251
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
188-424 8.34e-59

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


:

Pssm-ID: 334124 [Multi-domain]  Cd Length: 237  Bit Score: 200.20  E-value: 8.34e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    188 AKILAIISIMFIVLSTIALSLNTLPELQSLDEFgqstdnpqLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDL 267
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPESLNKL--------LEILDYVFTGIFTLEMLLKIIAAGFKRRYLRSPWNILDF 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    268 LAILPYYVTIFLTesnksvlqFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSS 347
Cdd:pfam00520  73 VVVLPSLISLVLS--------SVGSLSGLRVLRLLRVLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAI 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    348 L--VFFAEK-------DEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGK-------IVGGLCCIAGVLVIALPIPI 411
Cdd:pfam00520 145 IgyQLFGGKfytwenpDNGRTNFDNFPNAFLWLFQTMTTEGWGDILYDTIDGKgsfwayiYFVSFIILGGFLLLNLFIGV 224
                         250
                  ....*....|...
gi 4826784    412 IVNNFSEFYKEQK 424
Cdd:pfam00520 225 IIDNFQELTERTE 237
 
Name Accession Description Interval E-value
BTB_POZ_KCNB2 cd18412
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
15-141 2.30e-84

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily B member 2 (KCNB2); KCNB2, also called voltage-gated potassium channel subunit Kv2.2, mediates transmembrane potassium transport in excitable membranes, primarily in the brain and smooth muscle cells. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNB2 contributes to the delayed-rectifier voltage-gated potassium current in cortical pyramidal neurons and smooth muscle cells. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNB2 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349719  Cd Length: 127  Bit Score: 264.95  E-value: 2.30e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   15 SLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTS 94
Cdd:cd18412   1 SLPPEPVEIIRSKACSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTS 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 4826784   95 ILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKK 141
Cdd:cd18412  81 ILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKK 127
Kv2channel pfam03521
Kv2 voltage-gated K+ channel;
467-679 1.69e-62

Kv2 voltage-gated K+ channel;


Pssm-ID: 308887  Cd Length: 288  Bit Score: 212.46  E-value: 1.69e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    467 KNGENMGKKDKVQDNHLSPNKWKWTKRTLSETSSSKSFETK-----EQGSPEKA-RSSSSPQHLNVQQLEDMYNKMAKTQ 540
Cdd:pfam03521   1 KSGEGANKKESPDDNHLSPSRWKWSRRTLSETSSNKSYENKyqevsQQDSHEQLnNASSSPQHLSAQKLEELYNEITKTQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    541 SQPILNT--KESAAQS-KPKEELEMESIPSPVAPLPT-RTEGVIDMRSMSSIDSFISCATDFPEATRfshSPLTSLPS-- 614
Cdd:pfam03521  81 SHPSLNSsyQEQAEKPpAYEEEIEMEEVPCPQDQLLVaQTDAVTDMRSTSSIDSFASCATDFTETER---SPLPPYIGsh 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    615 ---------------KTGGSTAPEVGWRGALGASGGRFVEANP-----SPDASQ---------HSSFFIESPKSSMKTNN 665
Cdd:pfam03521 158 lqmrfpsdstpleehQRARSSQFLTLTKDKGFAPKDVTFEYTPidrtmNSDNSGsqsplqghlQFDSAVESPKSSLKGNN 237
                         250
                  ....*....|....
gi 4826784    666 PLKLRALKVNFMEG 679
Cdd:pfam03521 238 PLKSRSLKVNFKEN 251
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
188-424 8.34e-59

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 334124 [Multi-domain]  Cd Length: 237  Bit Score: 200.20  E-value: 8.34e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    188 AKILAIISIMFIVLSTIALSLNTLPELQSLDEFgqstdnpqLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDL 267
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPESLNKL--------LEILDYVFTGIFTLEMLLKIIAAGFKRRYLRSPWNILDF 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    268 LAILPYYVTIFLTesnksvlqFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSS 347
Cdd:pfam00520  73 VVVLPSLISLVLS--------SVGSLSGLRVLRLLRVLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAI 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    348 L--VFFAEK-------DEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGK-------IVGGLCCIAGVLVIALPIPI 411
Cdd:pfam00520 145 IgyQLFGGKfytwenpDNGRTNFDNFPNAFLWLFQTMTTEGWGDILYDTIDGKgsfwayiYFVSFIILGGFLLLNLFIGV 224
                         250
                  ....*....|...
gi 4826784    412 IVNNFSEFYKEQK 424
Cdd:pfam00520 225 IIDNFQELTERTE 237
BTB_2 pfam02214
BTB/POZ domain; In voltage-gated K+ channels this domain is responsible for subfamily-specific ...
33-132 1.30e-41

BTB/POZ domain; In voltage-gated K+ channels this domain is responsible for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. In KCTD1 this domain functions as a transcriptional repressor. It also mediates homomultimerisation of KCTD1 and interaction of KCTD1 with the transcription factor AP-2-alpha.


Pssm-ID: 308049  Cd Length: 93  Bit Score: 146.58  E-value: 1.30e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784     33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNthdsllevCDDYSLDDNEYFFDRHPGAFTSILNFYRT-GRLHMMEEMC 111
Cdd:pfam02214   1 VKLNVGGTRFETLKSTLTRFPDTRLGRLLELE--------CDDYDDDTNEYFFDRSPKHFETILNFYRTgGKLHRPEEVC 72
                          90       100
                  ....*....|....*....|.
gi 4826784    112 ALSFSQELDYWGIDEIYLESC 132
Cdd:pfam02214  73 LDEFLEEAEFYGLDELALELC 93
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
33-139 3.04e-17

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 77.35  E-value: 3.04e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784      33 VRLNVGGLAHEVLWRTLDRLPRTRLGklrdcnthdsLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEmCA 112
Cdd:smart00225   2 VTLVVGGKKFHAHKAVLAAHSPYFKA----------LFSSDFKESDKSEIYLDDVSPEDFRALLNFLYTGKLDLPEE-NV 70
                           90       100
                   ....*....|....*....|....*..
gi 4826784     113 LSFSQELDYWGIDEIyLESCCQARYHQ 139
Cdd:smart00225  71 EELLELADYLQIPGL-VELCEEFLLKL 96
PRK10537 PRK10537
voltage-gated potassium channel; Provisional
344-425 2.20e-06

voltage-gated potassium channel; Provisional


Pssm-ID: 236711 [Multi-domain]  Cd Length: 393  Bit Score: 50.79  E-value: 2.20e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   344 IFSSLVFfaeKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPI-----PIIVNNFSE 418
Cdd:PRK10537 152 TFGALYL---GDGFSPPIESLSTAFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFATSIsaifgPVIRGNLKR 228

                 ....*..
gi 4826784   419 FYKEQKR 425
Cdd:PRK10537 229 LVKGRIS 235
 
Name Accession Description Interval E-value
BTB_POZ_KCNB2 cd18412
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
15-141 2.30e-84

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily B member 2 (KCNB2); KCNB2, also called voltage-gated potassium channel subunit Kv2.2, mediates transmembrane potassium transport in excitable membranes, primarily in the brain and smooth muscle cells. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNB2 contributes to the delayed-rectifier voltage-gated potassium current in cortical pyramidal neurons and smooth muscle cells. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNB2 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349719  Cd Length: 127  Bit Score: 264.95  E-value: 2.30e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   15 SLPPEPMEIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTS 94
Cdd:cd18412   1 SLPPEPVEIIRSKACSRRVKINVGGLNHEVLWRTLDRLPRTRLGKLRDCNTHESLLEVCDDYNLNENEYFFDRHPGAFTS 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 4826784   95 ILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKK 141
Cdd:cd18412  81 ILNFYRTGKLHMMEEMCALSFGQELDYWGIDEIYLESCCQARYHQKK 127
BTB_POZ_KCNB1 cd18411
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
22-138 9.68e-84

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily B member 1 (KCNB1); KCNB1, also called delayed rectifier potassium channel 1 (DRK1) or voltage-gated potassium channel subunit Kv2.1, mediates transmembrane potassium transport in excitable membranes, primarily in the brain, but also in the pancreas and cardiovascular system. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNB1 is involved in the regulation of the action potential (AP) repolarization, duration and frequency of repetitive AP firing in neurons, muscle cells and endocrine cells and plays a role in homeostatic attenuation of electrical excitability throughout the brain. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNB1 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349718  Cd Length: 117  Bit Score: 263.02  E-value: 9.68e-84
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   22 EIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRT 101
Cdd:cd18411   1 EIIRSKACSRRVKLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHESLMEICDDYNLEENEYFFDRHPGAFTSILNFYRT 80
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 4826784  102 GRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18411  81 GKLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYH 117
BTB_POZ_Kv2_KCNB cd18378
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
30-138 3.18e-78

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNB/Kv2 subfamily of Shab-type voltage-dependent potassium channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv3, also known as subfamily C, contains two alpha subunit members, Kv2.1 (KCNB1) and Kv2.2 (KCNB2), which are orthologs of the Shab gene in Drosophila. They are delayed-rectifier potassium currents in various neurons, although their physiological roles often remain elusive. Kv2/KCNB subfamily alpha subunits form functional homo- or hetero-tetrameric channels (with other alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349687  Cd Length: 109  Bit Score: 248.08  E-value: 3.18e-78
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   30 SRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEE 109
Cdd:cd18378   1 SRRVLLNVGGVRHEVLWRTLDRLPRTRLGRLRECNTHESLLELCDDYDLEDNEYFFDRHPGAFTSILNFYRTGKLHMPEE 80
                        90       100
                ....*....|....*....|....*....
gi 4826784  110 MCALSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18378  81 MCVLSFSQELEYWGIDEIYLESCCQHRYH 109
BTB_POZ_Shab-like cd18413
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
30-138 3.88e-67

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster potassium voltage-gated channel protein Shab and similar proteins; Shab is a slow delayed rectifier voltage-gated potassium channel in Drosophila. It mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. Shab is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349720  Cd Length: 109  Bit Score: 218.21  E-value: 3.88e-67
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   30 SRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEE 109
Cdd:cd18413   1 NRRVVINVGGVKHEVLWRTLDRMPHTRLGKLRDSNTHEAIVELCDDYSLADNEYFFDRHPRSFASILNFYRTGKLHLVEE 80
                        90       100
                ....*....|....*....|....*....
gi 4826784  110 MCALSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18413  81 MCVLAFSDDLEYWGVDELYLESCCQHKYH 109
Kv2channel pfam03521
Kv2 voltage-gated K+ channel;
467-679 1.69e-62

Kv2 voltage-gated K+ channel;


Pssm-ID: 308887  Cd Length: 288  Bit Score: 212.46  E-value: 1.69e-62
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    467 KNGENMGKKDKVQDNHLSPNKWKWTKRTLSETSSSKSFETK-----EQGSPEKA-RSSSSPQHLNVQQLEDMYNKMAKTQ 540
Cdd:pfam03521   1 KSGEGANKKESPDDNHLSPSRWKWSRRTLSETSSNKSYENKyqevsQQDSHEQLnNASSSPQHLSAQKLEELYNEITKTQ 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    541 SQPILNT--KESAAQS-KPKEELEMESIPSPVAPLPT-RTEGVIDMRSMSSIDSFISCATDFPEATRfshSPLTSLPS-- 614
Cdd:pfam03521  81 SHPSLNSsyQEQAEKPpAYEEEIEMEEVPCPQDQLLVaQTDAVTDMRSTSSIDSFASCATDFTETER---SPLPPYIGsh 157
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    615 ---------------KTGGSTAPEVGWRGALGASGGRFVEANP-----SPDASQ---------HSSFFIESPKSSMKTNN 665
Cdd:pfam03521 158 lqmrfpsdstpleehQRARSSQFLTLTKDKGFAPKDVTFEYTPidrtmNSDNSGsqsplqghlQFDSAVESPKSSLKGNN 237
                         250
                  ....*....|....
gi 4826784    666 PLKLRALKVNFMEG 679
Cdd:pfam03521 238 PLKSRSLKVNFKEN 251
Ion_trans pfam00520
Ion transport protein; This family contains sodium, potassium and calcium ion channels. This ...
188-424 8.34e-59

Ion transport protein; This family contains sodium, potassium and calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane.


Pssm-ID: 334124 [Multi-domain]  Cd Length: 237  Bit Score: 200.20  E-value: 8.34e-59
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    188 AKILAIISIMFIVLSTIALSLNTLPELQSLDEFgqstdnpqLAHVEAVCIAWFTMEYLLRFLSSPKKWKFFKGPLNAIDL 267
Cdd:pfam00520   1 SRYFELFILLLILLNTIFLALETYFQPESLNKL--------LEILDYVFTGIFTLEMLLKIIAAGFKRRYLRSPWNILDF 72
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    268 LAILPYYVTIFLTesnksvlqFQNVRRVVQIFRIMRILRILKLARHSTGLQSLGFTLRRSYNELGLLILFLAMGIMIFSS 347
Cdd:pfam00520  73 VVVLPSLISLVLS--------SVGSLSGLRVLRLLRVLRLLRLIRRLEGLRTLVNSLIRSLKSLGNLLLLLLLFLFIFAI 144
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784    348 L--VFFAEK-------DEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGK-------IVGGLCCIAGVLVIALPIPI 411
Cdd:pfam00520 145 IgyQLFGGKfytwenpDNGRTNFDNFPNAFLWLFQTMTTEGWGDILYDTIDGKgsfwayiYFVSFIILGGFLLLNLFIGV 224
                         250
                  ....*....|...
gi 4826784    412 IVNNFSEFYKEQK 424
Cdd:pfam00520 225 IIDNFQELTERTE 237
BTB_POZ_Kv6_KCNG cd18382
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-140 4.71e-44

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNG/Kv6 subfamily of potassium voltage-gated channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv6, also known as subfamily G, includes KCNG1 (Kv6.1), KCNG2 (Kv6.2 or KCNF2), KCNG3 (Kv6.3) and KCNG4 (Kv6.4), which are regulatory alpha subunits and do not form functional channels on their own. KCNG1 can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1. KCNG2, also called cardiac potassium channel subunit, can form functional heterodimeric channels with KCNB1, and further modulates channel activity by shifting the threshold and the half-maximal activation to more negative values. KCNG3, also called voltage-gated potassium channel subunit Kv10.1, is an electrically silent modulatory subunit that can form functional heterotetrameric channels with KCNB1, and further promotes a reduction in the rate of activation and inactivation of the delayed rectifier voltage-gated potassium channel KCNB1. KCNG4 is a silent voltage-gated potassium (KvS) channel subunit that can form functional heterotetrameric channels with KCNB1, and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1.


Pssm-ID: 349691  Cd Length: 109  Bit Score: 154.13  E-value: 4.71e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18382   1 VIINVGGARYSLPWSTLDRFPLTRLSRLKACRSEDDILRVCDDYDVERNEFFFDRSPEAFGVILLFLRAGKLRLLREMCA 80
                        90       100
                ....*....|....*....|....*...
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYHQK 140
Cdd:cd18382  81 LSFQEELAYWGIEEAHLERCCKRRLLRR 108
BTB_POZ_KCNG1_2 cd18421
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-140 5.05e-44

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily G members, KCNG1 and KCNG2; KCNG1, also called voltage-gated potassium channel subunit Kv6.1 or kH2, functions as a regulatory alpha-subunit of voltage-gated potassium channel that can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1. KCNG2, also called cardiac potassium channel subunit or voltage-gated potassium channel subunit Kv6.2, is a new gamma-subunit of voltage-gated potassium channels that can form functional heterodimeric channels with KCNB1, and further modulates channel activity by shifting the threshold and the half-maximal activation to more negative values. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNG1 and KCNG2 are regulatory alpha subunits and do not form homomultimers. They form heteromultimers (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349728  Cd Length: 114  Bit Score: 154.53  E-value: 5.05e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEM 110
Cdd:cd18421   4 RHVIINVGGIKYRIPWTTLEEFPLTRLGQLKSCNNFDEIMDICDDYDVTCNEFFFDRNPCAFRTILTFLRAGKLRLLREM 83
                        90       100       110
                ....*....|....*....|....*....|
gi 4826784  111 CALSFSQELDYWGIDEIYLESCCQARYHQK 140
Cdd:cd18421  84 CALSFQEELLYWGIEEENLEWCCRRRLLQK 113
BTB_POZ_KCNS3 cd18428
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-138 1.67e-43

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily S member 3 (KCNS3); KCNS3, also called delayed-rectifier K(+) channel alpha subunit 3 or voltage-gated potassium channel subunit Kv9.3, is an alpha subunit of voltage-gated potassium channel linked to tissue oxygenation responses. It can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNS3 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349735  Cd Length: 108  Bit Score: 152.68  E-value: 1.67e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18428   3 INLNVGGFKQSVDQSTLLRFPHTRLGKLLNCHSEEAILELCDDYSVADKEYYFDRNPSLFRYVLNFYYTGKLHVMEELCV 82
                        90       100
                ....*....|....*....|....*.
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18428  83 FSFCQEIEYWGINELFIDSCCSNRYQ 108
BTB_POZ_Kv9_KCNS cd18384
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-138 1.81e-43

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNS/Kv9 subfamily of potassium voltage-gated channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv9, also known as subfamily S, includes KCNS1 (Kv9.1), KCNS2 (Kv9.2) and KCNS3 (Kv9.3). They are regulatory alpha subunits that cannot form functional homo-tetrameric channels. Both KCNS1 and KCNS2 are delayed-rectifier K(+) channel alpha subunits that can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1) and KCNB2 (also known as Kv2.2), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2. KCNS3 is a delayed-rectifier K(+) channel alpha subunit linked to tissue oxygenation responses. It can form functional heterotetrameric channels with KCNB1, and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1.


Pssm-ID: 349692  Cd Length: 106  Bit Score: 152.68  E-value: 1.81e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18384   1 IRINVGGFRRRLSASALLRFPGTRLGRLLACHSEEAILELCDDYDVAAREFYFDRNPGFFLYVLHFYRTGKLHVMDELCV 80
                        90       100
                ....*....|....*....|....*.
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18384  81 FSFSQEIEYWGINEFFLDSCCSYRYH 106
BTB_POZ_KCNS1 cd18426
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-138 4.05e-43

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily S member 1 (KCNS1); KCNS1, also called delayed-rectifier K(+) channel alpha subunit 1 or voltage-gated potassium channel subunit Kv9.1, is a modulatory alpha subunit of voltage-gated potassium channel that mediates neuropathic pain following nerve injury. It can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1) and KCNB2 (also known as Kv2.2), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNS1 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349733  Cd Length: 106  Bit Score: 151.58  E-value: 4.05e-43
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18426   1 ININVGGLKRRLSSSTLSKFPDTRLGRLLSCDSEESILQICDDYDVSAKEFYFDRNPGLFPYVLHFYQTGKLHIMEELCV 80
                        90       100
                ....*....|....*....|....*.
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18426  81 FSFSQEIEYWGINEFFLDSCCSYRYH 106
BTB_2 pfam02214
BTB/POZ domain; In voltage-gated K+ channels this domain is responsible for subfamily-specific ...
33-132 1.30e-41

BTB/POZ domain; In voltage-gated K+ channels this domain is responsible for subfamily-specific assembly of alpha-subunits into functional tetrameric channels. In KCTD1 this domain functions as a transcriptional repressor. It also mediates homomultimerisation of KCTD1 and interaction of KCTD1 with the transcription factor AP-2-alpha.


Pssm-ID: 308049  Cd Length: 93  Bit Score: 146.58  E-value: 1.30e-41
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784     33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNthdsllevCDDYSLDDNEYFFDRHPGAFTSILNFYRT-GRLHMMEEMC 111
Cdd:pfam02214   1 VKLNVGGTRFETLKSTLTRFPDTRLGRLLELE--------CDDYDDDTNEYFFDRSPKHFETILNFYRTgGKLHRPEEVC 72
                          90       100
                  ....*....|....*....|.
gi 4826784    112 ALSFSQELDYWGIDEIYLESC 132
Cdd:pfam02214  73 LDEFLEEAEFYGLDELALELC 93
BTB_POZ_KCNS2 cd18427
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-138 8.58e-41

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily S member 2 (KCNS2); KCNS2, also called delayed-rectifier K(+) channel alpha subunit 2 or voltage-gated potassium channel subunit Kv9.2, is a modulatory alpha subunit of voltage-gated potassium channel that can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1) and KCNB2 (also known as Kv2.2), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNS2 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349734  Cd Length: 107  Bit Score: 144.99  E-value: 8.58e-41
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18427   2 ISINVGGFKKRLRSHTLLRFPETRLGRLLSCRSKESILELCDDYDDTKNEFYFDRNPELFPYVLHFYNTGKLHVMGELCV 81
                        90       100
                ....*....|....*....|....*.
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYH 138
Cdd:cd18427  82 FSFSQEIEYWGINEFFIDSCCSYSYH 107
BTB_POZ_KCNV1 cd18424
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
35-142 1.90e-40

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily V member 1 (KCNV1); KCNV1, also called neuronal potassium channel alpha subunit HNKA or voltage-gated potassium channel subunit Kv8.1, is a new neuronal voltage-gated potassium channel alpha subunit with specific inhibitory properties towards Shab and Shaw channels. It modulates KCNB1 (also known as Kv2.1) and KCNB2 (also known as Kv2.2) channel activity by shifting the threshold for inactivation to more negative values and by slowing the rate of inactivation. It can also down-regulate the channel activity of KCNB1, KCNB2, KCNC4 (also known as Kv3.4) and KCND1 (also known as Kv4.1), possibly by trapping them in intracellular membranes. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNV1 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349731  Cd Length: 109  Bit Score: 144.19  E-value: 1.90e-40
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   35 LNVGGLAHEVLWRTLDRLPRTRLGKLRdCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALS 114
Cdd:cd18424   3 INVGGSRFVLSQQVLSSHPETRLGKLA-VSVRDSVLELCDDANFVDNEYFFDRSSQAFKYIMNYYKTGHLHVMEELCAIS 81
                        90       100
                ....*....|....*....|....*...
gi 4826784  115 FSQELDYWGIDEIYLESCCQARYHQKKE 142
Cdd:cd18424  82 FLQEIEYWGIDELSIDSCCRERYYRRKE 109
BTB_POZ_KCNG4 cd18423
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-140 1.11e-39

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily G member 4 (KCNG4); KCNG4, also called voltage-gated potassium channel subunit Kv6.4, is a silent voltage-gated potassium (KvS) channel subunit that can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1), and further modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNG4 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349730  Cd Length: 112  Bit Score: 141.88  E-value: 1.11e-39
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEM 110
Cdd:cd18423   2 REIIINVGGIKYLMPWSTLDEFPLTRLGKLKFCSSYEEIVQICDDYDEDTNEFFFDRNPCAFRMIVSFLAAGKLRLLREM 81
                        90       100       110
                ....*....|....*....|....*....|
gi 4826784  111 CALSFSQELDYWGIDEIYLESCCQARYHQK 140
Cdd:cd18423  82 CALSFQEELTYWGIEEANLERCCLRKLFQK 111
BTB_POZ_Kv cd18317
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-123 1.04e-34

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in voltage-gated potassium (Kv) channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. This family includes several groups of alpha subunits such as KCNA/Kv1 family of Shaker-type Kv channels, KCNB/Kv2 family of Shab-type Kv channels, KCNC/Kv3 family of Shaw-type Kv channels, KCND/Kv4 family of Shal-type Kv channels, KCNF/Kv5 subfamily of Kv channels, KCNG/Kv6 subfamily of Kv channels, KCNV/Kv8 subfamily of Kv channels, and KCNS/Kv9 subfamily of Kv channels. Kv alpha subunits form functional homo- or hetero-tetrameric channels (typically with other alpha subunits from the same subfamily) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif. KCNQ/Kv7 channels are not included in this family, since they do not contain a BTB/POZ domain.


Pssm-ID: 349626  Cd Length: 82  Bit Score: 126.57  E-value: 1.04e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNThdsllevcdDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18317   1 VVLNVGGTRFELSRSTLLRFPDTRLGKLAKESH---------AYDESTNEYFFDRNPEVFEAILDYYRTGELHLPSNVCP 71
                        90
                ....*....|.
gi 4826784  113 LSFSQELDYWG 123
Cdd:cd18317  72 ASFKEELEFWG 82
BTB_POZ_Kv3_KCNC cd18379
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-142 1.11e-34

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNC/Kv3 subfamily of Shaw-type voltage-dependent potassium channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv3, also known as subfamily C, contains four alpha subunit members, Kv3.1 (KCNC1), Kv3.2 (KCNC2), Kv3.3 (KCNC3), and Kv3.4 (KCNC4), which are orthologs of the Shaw gene in Drosophila. Unlike other Kv subfamilies, Kv3 channels typically open only at positive potentials and both, activation and deactivation, in response to changes in voltage are very rapid. They are uniquely associated with the ability of certain neurons to fire action potentials and to release neurotransmitter at high rates of up to 1,000 Hz. Kv3/KCNC subfamily alpha subunits form functional homo- or hetero-tetrameric channels (with other alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349688  Cd Length: 109  Bit Score: 127.51  E-value: 1.11e-34
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSllevcdDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18379   1 IVINVGGVRHETYKSTLRNLPDTRLAWLTETEASAF------DYDPVTGEFFFDRHPGVFAQILNYYRTGKLHCPADVCG 74
                        90       100       110
                ....*....|....*....|....*....|
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQARYHQKKE 142
Cdd:cd18379  75 PLFEEELAFWGIDETQIEPCCWMTYRQHRD 104
BTB_KCNC1_3 cd18414
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
30-142 1.43e-29

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily C members KCNC1 and KCNC3; KCNC1 (also called NGK2, voltage-gated potassium channel subunit Kv3.1, or voltage-gated potassium channel subunit Kv4) and KCNC3 (also called KSHIIID or voltage-gated potassium channel subunit Kv3.3) play important roles in the rapid repolarization of fast-firing brain neurons. Assuming opened or closed conformations in response to the voltage difference across the membrane, the proteins form tetrameric potassium-selective channels through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNC1 and KCNC3 are alpha subunit that form functional homo- or hetero-tetrameric channels (with other alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349721  Cd Length: 117  Bit Score: 113.51  E-value: 1.43e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   30 SRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLlevcdDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEE 109
Cdd:cd18414   2 SDRIVINVGGTRHETYRSTLRTLPGTRLAWLAEPDAHSNF-----DYDPRADEFFFDRHPGVFAHILNYYRTGKLHCPAD 76
                        90       100       110
                ....*....|....*....|....*....|...
gi 4826784  110 MCALSFSQELDYWGIDEIYLESCCQARYHQKKE 142
Cdd:cd18414  77 VCGPLYEEELAFWGIDETDVEPCCWMTYRQHRD 109
BTB_KCNC2_4 cd18415
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
30-142 1.63e-29

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily C members KCNC2 and KCNC4; KCNC2, also called Shaw-like potassium channel or voltage-gated potassium channel Kv3.2, is a delayed rectifier voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes, primarily in the brain. It contributes to the regulation of the fast action potential repolarization and in sustained high-frequency firing in neurons of the central nervous system. KCNC4, also called KSHIIIC or voltage-gated potassium channel subunit Kv3.4, is a novel high-voltage-activating, tetraethylammonium (TEA)-sensitive, type-A potassium channel that mediates the voltage-dependent potassium ion permeability of excitable membranes. It plays a pivotal role in oxidative stress-related neural cell damage as an oxidation-sensitive channel. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNC2 and KCNC4 are alpha subunit that form functional homo- or hetero-tetrameric channels (with other alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349722  Cd Length: 124  Bit Score: 113.33  E-value: 1.63e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   30 SRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVC------DDYSLDDNEYFFDRHPGAFTSILNFYRTGR 103
Cdd:cd18415   1 NERIILNVGGTRHETYRSTLKTLPGTRLALLASSDPQGDCLTQCsqvggsDGSPGGGNEFFFDRHPGVFAYVLNYYRTGK 80
                        90       100       110
                ....*....|....*....|....*....|....*....
gi 4826784  104 LHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKE 142
Cdd:cd18415  81 LHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRD 119
BTB_POZ_KCNG3 cd18422
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-136 8.49e-29

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily G member 3 (KCNG3); KCNG3, also called voltage-gated potassium channel subunit Kv6.3 or voltage-gated potassium channel subunit Kv10.1, is an electrically silent modulatory subunit that can form functional heterotetrameric channels with KCNB1 (also known as Kv2.1), and further promotes a reduction in the rate of activation and inactivation of the delayed rectifier voltage-gated potassium channel KCNB1. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNG3 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349729  Cd Length: 111  Bit Score: 111.10  E-value: 8.49e-29
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18422   1 VTLNVGGTRYSFSREVIKDFPLRRVSRLHGCLSEQDVLEVCDDYDRERNEYFFDRHSEAFGFIMLYVKYGKLRFVPQMCE 80
                        90       100
                ....*....|....*....|....
gi 4826784  113 LSFSQELDYWGIDEIYLESCCQAR 136
Cdd:cd18422  81 LSFYNEMIYWGLERSHLEYCCQRR 104
BTB_Shaw-like cd18416
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-142 1.81e-28

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel protein Shaw; Shaw, also called Shaw2, is a voltage-gated potassium channel in Drosophila. It mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. Shaw is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349723  Cd Length: 112  Bit Score: 110.05  E-value: 1.81e-28
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDC-NTHDSLLevcddyslddNEYFFDRHPGAFTSILNFYRTGRLHMMEEM 110
Cdd:cd18416   3 RVVLNVGGIRHETYKATLKKIPATRLSRLTEAlANYDPVL----------NEYFFDRHPGVFAQILNYYRTGKLHYPTDV 72
                        90       100       110
                ....*....|....*....|....*....|..
gi 4826784  111 CALSFSQELDYWGIDEIYLESCCQARYHQKKE 142
Cdd:cd18416  73 CGPLFEEELEFWGLDANQVEPCCWMTYTAHRD 104
BTB_POZ_KCNV2 cd18425
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
35-140 1.14e-27

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily V member 2 (KCNV2); KCNV2, also called voltage-gated potassium channel subunit Kv8.2, is a modulatory voltage-gated potassium channel alpha subunit that modulates channel activity by shifting the threshold and the half-maximal activation to more negative values. KCNV2 is essential for visual function and cone survival. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNV2 is a regulatory alpha subunit that cannot form a functional homo-tetrameric channel. It forms hetero-tetrameric channels (with other functional alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349732  Cd Length: 108  Bit Score: 107.54  E-value: 1.14e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   35 LNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCALS 114
Cdd:cd18425   3 INVGGTSYQISYRVAASYPKTRIGRLATYTDRSRKLDLCDDYNVQNDEYFFDRDPAVFHHIYNFYRTGVLWVKDELCPRN 82
                        90       100
                ....*....|....*....|....*.
gi 4826784  115 FSQELDYWGIDEIYLESCCQARYHQK 140
Cdd:cd18425  83 FLEEINYWGVRIKNTPRCCRISFEER 108
BTB_POZ_Kv5_KCNF1 cd18381
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-144 1.80e-27

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNF/Kv5 subfamily of potassium voltage-gated channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv5, also known as subfamily F, only contains KCNF1 (also known as Kv5.1 or kH1), which functions as a regulatory alpha-subunit of voltage-gated potassium channel that when coassembled with Kv2.1 can modulate gating in a physiologically relevant manner. It forms hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349690  Cd Length: 116  Bit Score: 107.15  E-value: 1.80e-27
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDC--NTHDSLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEM 110
Cdd:cd18381   3 IVVNVGGVRQVLYGDVLNRYPETRLAELLNClsGGYDAIFSLCDDYDPGKREFYFDRDPDAFKCIIEVYYYGEIHMKKGI 82
                        90       100       110
                ....*....|....*....|....*....|....
gi 4826784  111 CALSFSQELDYWGIDEIYLESCCQARYHQKKEQM 144
Cdd:cd18381  83 CPICFKNEMDFWRVDLDFLDECCKCHLSEKREEL 116
BTB_POZ_Kv4_KCND cd18380
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-143 7.90e-23

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCND/Kv4 subfamily of Shal-type voltage-dependent potassium channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv4, also known as subfamily D, contains three alpha subunit members, Kv4.1 (KCND1), Kv4.2 (KCND2), and Kv4.3 (KCND3), which are orthologs of the Shal gene in Drosophila. They are A-type potassium channels that mediate the native, fast inactivating (A-type) K+ current (IA) described both in the nervous system (A currents) and the heart (transient outward current). Kv4/KCND subfamily alpha subunits form functional homo- or hetero-tetrameric channels through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif. They are modulated by cytoplasmic KChIPs/KCNIPs (Kv-channel interacting proteins), which are small calcium binding proteins with EF-hand-like domains.


Pssm-ID: 349689  Cd Length: 102  Bit Score: 93.59  E-value: 7.90e-23
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSllevcddyslDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMC 111
Cdd:cd18380   1 RIVINVSGRRFETWKNTLEKYPDTLLGSTEKEFFYDD----------DTKEYFFDRDPEIFRHILNFYRTGKLHYPRHEC 70
                        90       100       110
                ....*....|....*....|....*....|..
gi 4826784  112 ALSFSQELDYWGIDEIYLESCCQARYHQKKEQ 143
Cdd:cd18380  71 ISAYDDELAFFGILPEIIGDCCYEDYRDRKRE 102
BTB_POZ_Shal-like cd18420
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
12-143 9.51e-20

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster potassium voltage-gated channel protein Shal and similar proteins; Drosophila melanogaster Shal, also called Shaker cognate l or Shal2, is a transient potassium current (I(A)) channel, which is required for maintaining excitability during repetitive firing and normal locomotion in Drosophila. It may play a role in the nervous system and in the regulation of beating frequency in pacemaker cells. Shal mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. Shal is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349727 [Multi-domain]  Cd Length: 139  Bit Score: 86.06  E-value: 9.51e-20
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   12 STSSLPPEPMEIVRSKACSRRVRLNVGGLAHEVlWR-TLDRLPRTRLGKlrdcNTHDSLlevcddYSLDDNEYFFDRHPG 90
Cdd:cd18420  17 ANNPLPPPPVDQERRRTDDEKLIINVSGRRFET-WRnTLEKYPDTLLGS----NEREFF------YDEETKEYFFDRDPD 85
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|...
gi 4826784   91 AFTSILNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQ 143
Cdd:cd18420  86 IFRHILNYYRTGKLHYPKHECLTAYDEELAFFGIMPDIIGDCCYEDYRDRKRE 138
BTB_POZ_KCND1 cd18417
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
16-143 2.91e-19

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily D member 1 (KCND1); KCND1, also called voltage-gated potassium channel subunit Kv4.1, is a pore-forming subunit of voltage-gated rapidly inactivating A-type potassium channels. It may contribute to I (To) current in heart and I (Sa) current in neurons. Its properties are modulated by interactions with other alpha subunits and with regulatory subunits. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCND1 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv4/KCND alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif. It is modulated by cytoplasmic KChIPs/KCNIPs (Kv-channel interacting proteins), which are small calcium binding proteins with EF-hand-like domains.


Pssm-ID: 349724 [Multi-domain]  Cd Length: 138  Bit Score: 84.62  E-value: 2.91e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   16 LPPEPmeIVRSKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGklrdcNTHDSLLevcddYSLDDNEYFFDRHPGAFTSI 95
Cdd:cd18417  22 MPKPP--SDKKRRNDEILVVNVSGRRFQTWKNTLDRYPDTLLG-----SSEKEFF-----YNEDTQEYFFDRDPEMFRHI 89
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*...
gi 4826784   96 LNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQ 143
Cdd:cd18417  90 LNFYRTGRLHYPRHECIQAFDEELSFYGIIPEIIGDCCLEEYRDRKKE 137
BTB smart00225
Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. ...
33-139 3.04e-17

Broad-Complex, Tramtrack and Bric a brac; Domain in Broad-Complex, Tramtrack and Bric a brac. Also known as POZ (poxvirus and zinc finger) domain. Known to be a protein-protein interaction motif found at the N-termini of several C2H2-type transcription factors as well as Shaw-type potassium channels. Known structure reveals a tightly intertwined dimer formed via interactions between N-terminal strand and helix structures. However in a subset of BTB/POZ domains, these two secondary structures appear to be missing. Be aware SMART predicts BTB/POZ domains without the beta1- and alpha1-secondary structures.


Pssm-ID: 197585 [Multi-domain]  Cd Length: 97  Bit Score: 77.35  E-value: 3.04e-17
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784      33 VRLNVGGLAHEVLWRTLDRLPRTRLGklrdcnthdsLLEVCDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEmCA 112
Cdd:smart00225   2 VTLVVGGKKFHAHKAVLAAHSPYFKA----------LFSSDFKESDKSEIYLDDVSPEDFRALLNFLYTGKLDLPEE-NV 70
                           90       100
                   ....*....|....*....|....*..
gi 4826784     113 LSFSQELDYWGIDEIyLESCCQARYHQ 139
Cdd:smart00225  71 EELLELADYLQIPGL-VELCEEFLLKL 96
BTB_POZ_KCND2 cd18418
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-143 4.39e-17

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily D member 2 (KCND2); KCND2, also called voltage-gated potassium channel subunit Kv4.2, is a major pore-forming subunit in somatodendritic subthreshold A-type potassium current I(SA) channels. It mediates transmembrane potassium transport in excitable membranes, primarily in the brain. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCND2 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv4/KCND alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif. It is modulated by cytoplasmic KChIPs/KCNIPs (Kv-channel interacting proteins), which are small calcium binding proteins with EF-hand-like domains.


Pssm-ID: 349725  Cd Length: 103  Bit Score: 77.31  E-value: 4.39e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKL-RDCNTHDsllevcddyslDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMC 111
Cdd:cd18418   2 IVLNVSGTRFQTWRNTLERYPDTLLGSSeRDFFYHE-----------ETQEYFFDRDPDIFRHILNFYRTGKLHYPRHEC 70
                        90       100       110
                ....*....|....*....|....*....|..
gi 4826784  112 ALSFSQELDYWGIDEIYLESCCQARYHQKKEQ 143
Cdd:cd18418  71 ISAYDEELAFFGIIPEIIGDCCYEEYKDRRRE 102
BTB_POZ_KCND3 cd18419
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
20-143 5.85e-17

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily D member 3 (KCND3); KCND3, also called voltage-gated potassium channel subunit Kv4.3, is a pore-forming subunit of voltage-gated rapidly inactivating A-type potassium channels. Mutations in KCND3 cause spinocerebellar ataxia. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCND3 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv4/KCND alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif. It is modulated by cytoplasmic KChIPs/KCNIPs (Kv-channel interacting proteins), which are small calcium binding proteins with EF-hand-like domains.


Pssm-ID: 349726 [Multi-domain]  Cd Length: 138  Bit Score: 78.09  E-value: 5.85e-17
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   20 PMEIVRSKACSRR---VRLNVGGLAHEVlWR-TLDRLPRTRLGKlrdcnTHDSLLevcddYSLDDNEYFFDRHPGAFTSI 95
Cdd:cd18419  21 PMPLAPADKNKRQdelIVLNVSGRRFQT-WRtTLERYPDTLLGS-----TEKEFF-----FNEDTKEYFFDRDPEVFRCV 89
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*...
gi 4826784   96 LNFYRTGRLHMMEEMCALSFSQELDYWGIDEIYLESCCQARYHQKKEQ 143
Cdd:cd18419  90 LNFYRTGKLHYPRYECISAYDEELAFYGILPEIIGDCCYEEYKDRKRE 137
BTB_POZ_Kv_KCTD cd18187
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-122 2.82e-13

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in voltage-gated potassium (Kv) channels and potassium channel tetramerization domain-containing (KCTD) proteins; This family includes two protein groups: voltage-gated potassium (Kv) channels and potassium channel tetramerization domain-containing (KCTD) proteins. Kv channels are membrane proteins with fundamental physiological roles. They are responsible for a variety of electrical phenomena, such as the repolarization of the action potential, spike frequency adaptation, synaptic repolarization, and smooth muscle contraction. KCTD proteins play crucial roles in a variety of fundamental biological processes, such as protein ubiquitination and degradation, suppression of proliferation or transcription, cytoskeleton regulation, tetramerization and gating of ion channels, and others. All family members contain the BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization.


Pssm-ID: 349498  Cd Length: 83  Bit Score: 65.57  E-value: 2.82e-13
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEvcddyslDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18187   1 VVLNVSGTRFVTNRQTLTRHPDTLLGRMFKPGREFTFPN-------ETGEYFIDRDPTVFRTILNYYRTGKLNCPDGISI 73
                        90
                ....*....|
gi 4826784  113 LSFSQELDYW 122
Cdd:cd18187  74 PDLREECDFY 83
Ion_trans_2 pfam07885
Ion channel; This family includes the two membrane helix type ion channels found in bacteria.
337-413 4.37e-12

Ion channel; This family includes the two membrane helix type ion channels found in bacteria.


Pssm-ID: 336849 [Multi-domain]  Cd Length: 74  Bit Score: 61.88  E-value: 4.37e-12
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4826784    337 FLAMGIMIFSSLVFFaekDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPIPIIV 413
Cdd:pfam07885   1 IILLLVLIFGTVYYL---LEEFWEGWSFLDALYFSFVTLTTVGYGDIVPLTDAGRLFTIVYILIGIPLFAIFLAVLG 74
BTB_POZ_KCNA7 cd18408
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
28-126 1.19e-11

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 7 (KCNA7); KCNA7, also called voltage-gated potassium channel subunit Kv1.7, mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNA7 plays an important role in the repolarization of cell membranes. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA7 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349715  Cd Length: 115  Bit Score: 62.25  E-value: 1.19e-11
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   28 ACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHdsllevcddYSLDDNEYFFDRHPGAFTSILNFYRT-GRLHM 106
Cdd:cd18408   3 GCCERVVLNVAGLRFETRARTLGRFPDTLLGDPARRGRF---------YDDRRREYFFDRHRPSFDAVLYYYQSgGRLRR 73
                        90       100
                ....*....|....*....|
gi 4826784  107 MEEMCALSFSQELDYWGIDE 126
Cdd:cd18408  74 PAHVPLDVFLEEVAFYGLGA 93
BTB_POZ_KCTD-like cd18316
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-104 1.13e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing proteins; The potassium channel tetramerization domain (KCTD) family proteins contain the BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD proteins play crucial roles in a variety of fundamental biological processes, such as protein ubiquitination and degradation, suppression of proliferation or transcription, cytoskeleton regulation, tetramerization and gating of ion channels and others. Some KCTD proteins are involved in protein ubiquitination as part of the CRL (Cullin RING Ligase) E3 ligases. Some others show Cullin-independent functions including binding and regulation of GABA (gamma-aminobutyric acid) receptors (KCTD8, KCTD12 and KCTD16) and inhibition of AP-2 function (KCTD15). KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization.


Pssm-ID: 349625  Cd Length: 83  Bit Score: 55.26  E-value: 1.13e-09
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSllevcddySLDDNEYFFDRHPGAFTSILNFYRTGRL 104
Cdd:cd18316   1 VKLNVGGTLFTTSRSTLLKDPDSLLAALFSGRWPLP--------RDEDGSIFIDRDPELFRHILNFLRTGKL 64
BTB_POZ_Kv1_KCNA cd18377
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-104 1.57e-09

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in KCNA/Kv1 subfamily of Shaker-type voltage-dependent potassium channels; Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. The potassium voltage-gated channel subfamily Kv1, also known as subfamily A, contains eight alpha subunit members, Kv1.1 (KCNA1), Kv1.2 (KCNA2), Kv1.3 (KCNA3), Kv1.4 (KCNA4), Kv1.5 (KCNA5), Kv1.6 (KCNA6), Kv1.7 (KCNA7), and Kv1.8 (KCNA10), which are orthologs of the Shaker gene in Drosophila. They are delayed rectifiers except for Kv1.4 (KCNA4), which is an A-type potassium channel. Delayed rectifiers are slow opening and closing voltage-gated potassium channels. Because of their delayed activation kinetics, they play an important role in controlling action potential duration. A-type channels are fast/rapidly inactivating potassium channels. Kv1/KCNA subfamily alpha subunits form functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349686  Cd Length: 85  Bit Score: 54.99  E-value: 1.57e-09
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGklrDCNTHDSLlevcddYSLDDNEYFFDRHPGAFTSILNFYRT-GRL 104
Cdd:cd18377   1 ERVVINVSGLRFETQLKTLAQFPNTLLG---DPNKRMRF------FDPLRNEYFFDRNRPSFDAILYYYQSgGRL 66
BTB_POZ_Shaker-like cd18410
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-126 2.61e-08

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Drosophila melanogaster potassium voltage-gated channel protein Shaker and similar proteins; Shaker, also termed protein minisleep, represents a family of putative potassium channel proteins in the nervous system of Drosophila. It is a voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Shaker plays a role in the regulation of sleep need or efficiency. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. Shaker is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349717  Cd Length: 100  Bit Score: 52.24  E-value: 2.61e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGK-LRDCNTHDSLlevcddysldDNEYFFDRHPGAFTSILNFYRT-GRLHMMEE 109
Cdd:cd18410   2 RVVINVSGLRFETQLKTLNQFPDTLLGDpQRRNRYYDPL----------RNEYFFDRNRPSFDAILYYYQSgGRLRRPVN 71
                        90
                ....*....|....*..
gi 4826784  110 MCALSFSQELDYWGIDE 126
Cdd:cd18410  72 VPLDVFSEEIKFYELGE 88
BTB_POZ_KCNA2_KCNA3 cd18403
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-130 2.57e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A members 2 (KCNA2) and 3 (KCNA3); KCNA2 is also called NGK1, voltage-gated K(+) channel HuKIV, voltage-gated potassium channel HBK5, or voltage-gated potassium channel subunit Kv1.2. KCNA3 is also called HGK5, HLK3, HPCN3, voltage-gated K(+) channel HuKIII, or voltage-gated potassium channel subunit Kv1.3. KCNA2 and KCNA3 mediate transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNA2 primarily functions in the brain and the central nervous system, but also in the cardiovascular system. It prevents aberrant action potential firing and regulates neuronal output. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA2 and KCNA3 are alpha subunits that form functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through their BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349711  Cd Length: 99  Bit Score: 49.20  E-value: 2.57e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEvcddyslddNEYFFDRHPGAFTSILNFYRT-GRLHMMEEM 110
Cdd:cd18403   2 RVVINISGLRFETQLKTLAQFPETLLGDPKKRMRYFDPLR---------NEYFFDRNRPSFDAILYYYQSgGRLRRPVNV 72
                        90       100
                ....*....|....*....|
gi 4826784  111 CALSFSQELDYWGIDEIYLE 130
Cdd:cd18403  73 PLDIFSEEIRFYELGEEAME 92
BTB_POZ_KCNA10 cd18409
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-102 4.94e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 10 (KCNA10); KCNA10, also called voltage-gated potassium channel subunit Kv1.8, is a cyclic nucleotide-gated, voltage-activated potassium channel that mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNA10 is expressed in proximal tubular cells, glomerular and vascular endothelial cells, as well as in vascular smooth muscle cells. It may facilitate proximal tubular sodium absorption by stabilizing cell membrane voltage. The channel activity is up-regulated by cAMP. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA10 is an alpha subunit that forms functional homotetrameric channels through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349716  Cd Length: 87  Bit Score: 47.91  E-value: 4.94e-07
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLG-KLRDCNTHDSLlevcddysldDNEYFFDRHPGAFTSILNFYRTG 102
Cdd:cd18409   1 QKVIINIAGLRFETQLKTLDQFPDTLLGdPEKRMKYFDSM----------RNEYFFDRNRPSFDGILYYYQSG 63
BTB_POZ_KCNA1 cd18402
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
26-126 5.32e-07

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 1 (KCNA1); KCNA1 is also called voltage-gated K(+) channel HuKI, voltage-gated potassium channel HBK1, or voltage-gated potassium channel subunit Kv1.1. It mediates transmembrane potassium transport in excitable membranes, primarily in the brain and the central nervous system, but also in the kidney. It is involved in the regulation of the membrane potential and nerve signaling, and prevents neuronal hyperexcitability. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA1 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349710  Cd Length: 98  Bit Score: 48.49  E-value: 5.32e-07
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   26 SKACSRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEvcddyslddNEYFFDRHPGAFTSILNFYRT-GRL 104
Cdd:cd18402   4 DHECCERVVINIAGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLR---------NEYFFDRNRPSFDAILYYYQSgGRL 74
                        90       100
                ....*....|....*....|..
gi 4826784  105 HMMEEMCALSFSQELDYWGIDE 126
Cdd:cd18402  75 RRPVNVPLDMFSEEIKFYELGE 96
PRK10537 PRK10537
voltage-gated potassium channel; Provisional
344-425 2.20e-06

voltage-gated potassium channel; Provisional


Pssm-ID: 236711 [Multi-domain]  Cd Length: 393  Bit Score: 50.79  E-value: 2.20e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   344 IFSSLVFfaeKDEDDTKFKSIPASFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPI-----PIIVNNFSE 418
Cdd:PRK10537 152 TFGALYL---GDGFSPPIESLSTAFYFSIVTMSTVGYGDIVPVSESARLFTISVIILGITVFATSIsaifgPVIRGNLKR 228

                 ....*..
gi 4826784   419 FYKEQKR 425
Cdd:PRK10537 229 LVKGRIS 235
BTB_POZ_KCTD2 cd18389
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-124 3.06e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing protein 2 (KCTD2); KCTD2 is a BTB/POZ domain-containing protein that functions as an adaptor of Cullin3 E3 ubiquitin ligase. It suppresses gliomagenesis by destabilizing c-Myc. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. KCTD5 and KCTD17 BTB domain, highly similar to KCTD2, form pentamer structures.


Pssm-ID: 349697  Cd Length: 105  Bit Score: 46.52  E-value: 3.06e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGKLrdCNTHDSLlevcDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEM 110
Cdd:cd18389   1 KWVRLNVGGTYFVSTKQTLCRDPKSFLYRL--CQEDPDL----DSDKDETGAYLIDRDPTYFGPILNYLRHGKLIINKEL 74
                        90
                ....*....|....
gi 4826784  111 CALSFSQELDYWGI 124
Cdd:cd18389  75 AEEGVLEEAEFYNI 88
BTB_POZ_KCNA4 cd18405
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-126 4.22e-06

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 4 (KCNA4); KCNA4 is also called HPCN2, or voltage-gated K(+) channel HuKII, voltage-gated potassium channel HBK4, voltage-gated potassium channel HK1, or voltage-gated potassium channel subunit Kv1.4. It mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA4 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349712  Cd Length: 97  Bit Score: 45.76  E-value: 4.22e-06
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTHDSLLEvcddyslddNEYFFDRHPGAFTSILNFYRT-GRLHMMEEM 110
Cdd:cd18405   2 RVVINVSGLRFETQLKTLAQFPETLLGDPEKRMRYFDPLR---------NEYFFDRNRPSFDAILYYYQSgGRLKRPVNV 72
                        90
                ....*....|....*.
gi 4826784  111 CALSFSQELDYWGIDE 126
Cdd:cd18405  73 PFDIFSEEVKFYELGE 88
BTB_POZ_FIP2-like cd18376
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-127 1.41e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in Arabidopsis thaliana FH protein interacting protein FIP2 and similar proteins; FIP2 may act as a substrate-specific adaptor of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. It contains a BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization.


Pssm-ID: 349685  Cd Length: 89  Bit Score: 44.16  E-value: 1.41e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPrtrlgklrdcnthDSLLEV--CDDYSLDDNE---YFFDRHPGAFTSILNFYRTGRLHMM 107
Cdd:cd18376   1 VKLNVGGQKFTTTLDTLTKDP-------------DSMLAAmfSGRHSLKKDEdgsYFIDRDGTHFRHILNYLRDGEVKIP 67
                        90       100
                ....*....|....*....|....
gi 4826784  108 EEmcALSFSQEL----DYWGIDEI 127
Cdd:cd18376  68 TE--DRSVLKELleeaEYYQLRGL 89
BTB_POZ_KCNA6 cd18407
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
32-185 2.42e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 6 (KCNA6); KCNA6, also called voltage-gated potassium channel HBK2 or voltage-gated potassium channel subunit Kv1.6, mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNA6 is distributed primarily in neurons of central and peripheral nervous systems. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA6 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349714  Cd Length: 127  Bit Score: 44.60  E-value: 2.42e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   32 RVRLNVGGLAHEVLWRTLDRLPRTRLGKL-RDCNTHDSLlevcddysldDNEYFFDRHPGAFTSILNFYRT-GRLHMmee 109
Cdd:cd18407   2 RLVINISGLRFETQLRTLSIFPDTLLGDPsRRVRYFDPL----------RNEYFFDRNRPSFDAILYYYQSgGRLRR--- 68
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784  110 mcalSFSQELDywgideIYLEsccQARYHQkkeqmneeLKREA-ETLREREG---EEFDNTCCAEKRKKLWDLLEKPNSS 185
Cdd:cd18407  69 ----PVHVPLD------IFLE---EIRFYQ--------LGQEAiETFREDEGfipEEEKPLPSHHFQRQVWLLFEYPESS 127
BTB_POZ_KCNA5 cd18406
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
31-102 2.49e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium voltage-gated channel subfamily A member 5 (KCNA5); KCNA5, also called HPCN1, voltage-gated potassium channel HK2, or voltage-gated potassium channel subunit Kv1.5, mediates transmembrane potassium transport in excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a tetrameric potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient. KCNA5 may play a role in regulating the secretion of insulin in normal pancreatic islets. Voltage-gated potassium (Kv) channels are composed of alpha subunits, which form the actual conductance pore, and cytoplasmic beta subunits, which are auxiliary proteins that associate with alpha subunits to modulate the activity of the Kv channel. KCNA5 is an alpha subunit that forms functional homo- or hetero-tetrameric channels (with other Kv1/KCNA alpha subunits) through its BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif.


Pssm-ID: 349713  Cd Length: 97  Bit Score: 43.70  E-value: 2.49e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4826784   31 RRVRLNVGGLAHEVLWRTLDRLPRTRLGKlrdcntHDSLLEVCDDYSlddNEYFFDRHPGAFTSILNFYRTG 102
Cdd:cd18406   1 ERVIINIAGLRFETQLGTLNQFPDTLLGD------PDKRMRYFDPLR---NEYFFDRNRPSFDGILYFYQSG 63
BTB_POZ_KCTD11 cd18370
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-108 3.76e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing protein KCTD11; KCTD11 may function as an antagonist of the Hedgehog pathway of cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in the undifferentiated state. It is a probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. It contains a BTB/POZ domain; in some cases the domain may be truncated. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. Variants of the human/mouse KCTD11 appear to contain truncated BTB/POZ domains.


Pssm-ID: 349679  Cd Length: 88  Bit Score: 42.68  E-value: 3.76e-05
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNThdsllEVCDDYSLD-DNEYFFDRHPGAFTSILNFYRTGRLHMME 108
Cdd:cd18370   1 VTLNVGGTLYSTTLETLTRFPDSMLGAMFRAGT-----PIPPNLNMQgGGHYFIDRDGKAFRHILNFLRLGRLDLPR 72
BTB_POZ_KCTD1-like cd18361
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-146 6.09e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing proteins, KCTD1 and KCTD15; This subfamily of KCTD proteins includes KCTD1 and KCTD15. KCTD1 is a nuclear BTB/POZ domain-containing protein that acts as a transcriptional repressor and mediates protein-protein interactions through a BTB domain. It represses the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C. It also functions as a novel inhibitor of the Wnt signaling pathway. Mutations in KCTD1 cause scalp-ear-nipple (SEN) syndrome. KCTD15 is a BTB/POZ domain-containing protein that plays a role in the regulation of neural crest (NC) formation and other steps in embryonic development. It inhibits AP2 transcriptional activity by interaction with its activation domain. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. The KCTD1 BTB domains form pentamers.


Pssm-ID: 349670  Cd Length: 94  Bit Score: 42.36  E-value: 6.09e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCNTH---DSLLEvcddyslddnEYFFDRHPGAFTSILNFYRTGRLHMMEe 109
Cdd:cd18361   1 VHIDVGGHIYTSSLETLTKYPESRLGKLFNGSIPivlDSLKQ----------HYFIDRDGKMFRHILNFLRTSKLLLPD- 69
                        90       100       110
                ....*....|....*....|....*....|....*..
gi 4826784  110 mcalsfsqelDYWGIDEIYLEsccqARYHQKKEQMNE 146
Cdd:cd18361  70 ----------DFTEFDLLYEE----ARYYELQPMVKQ 92
BTB_POZ_KCTD5 cd18390
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
30-127 9.08e-05

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing protein 5 (KCTD5); KCTD5 is a BTB/POZ domain-containing protein that functions as a substrate adaptor for cullin3 based ubiquitin E3 ligases. It is a negative regulator of the AKT pathway, a key signaling cascade frequently deregulated in cancer. KCTD5 does not impact the operation of Kv4.2, Kv3.4, Kv2.1, or Kv1.2 channels. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. KCTD5 forms pentamers mediated by its BTB domain.


Pssm-ID: 349698  Cd Length: 112  Bit Score: 42.29  E-value: 9.08e-05
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   30 SRRVRLNVGGLAHEVLWRTLDRLPRTRLGKLrdCNTHDSLlevcDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEE 109
Cdd:cd18390   4 SKWVRLNVGGTYFLTTRQTLCRDPKSFLYRL--CQADPDL----DSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKD 77
                        90
                ....*....|....*...
gi 4826784  110 MCALSFSQELDYWGIDEI 127
Cdd:cd18390  78 LAEEGVLEEAEFYNITSL 95
BTB_POZ_KCTD17 cd18391
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-124 1.67e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing protein 17 (KCTD17); KCTD17 is a BTB/POZ domain-containing protein that functions as a substrate-adaptor for cullin3-RING ubiquitin ligases that polyubiquitylates trichoplein, a protein involved in ciliogenesis down-regulation. It is a positive regulator of ciliogenesis, playing a crucial role in the initial steps of axoneme extension. A missense mutation in KCTD17 causes autosomal dominant myoclonus-dystonia (M-D). The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. The KCTD17 BTB domains form pentamers.


Pssm-ID: 349699  Cd Length: 101  Bit Score: 41.52  E-value: 1.67e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLrdCNTHDslLEVCDDyslDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18391   3 VRLNVGGTVFLTTRQTLCREQKSFLSRL--CQGEE--LQSDRD---ETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAE 75
                        90
                ....*....|..
gi 4826784  113 LSFSQELDYWGI 124
Cdd:cd18391  76 EGVLEEAEFYNI 87
BTB_POZ_KCTD2-like cd18362
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-104 3.07e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing proteins KCTD2, KCTD5, and KCTD17, and similar proteins; This subfamily includes potassium channel tetramerization domain-containing proteins KCTD2, KCTD5, and KCTD17, all of which function as adaptors of Cullin3 based ubiquitin E3 ubiquitin ligases. KCTD2 suppresses gliomagenesis by destabilizing c-Myc. KCTD5 is a negative regulator of the AKT pathway, a key signaling cascade frequently deregulated in cancer. KCTD5 does not impact the operation of Kv4.2, Kv3.4, Kv2.1, or Kv1.2 channels. KCTD17 polyubiquitylates trichoplein, a protein involved in ciliogenesis down-regulation. It is a positive regulator of ciliogenesis, playing a crucial role in the initial steps of axoneme extension. A missense mutation in KCTD17 causes autosomal dominant myoclonus-dystonia (M-D). The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. KCTD5 and KCTD17 BTB domains form pentamer structures.


Pssm-ID: 349671  Cd Length: 85  Bit Score: 40.04  E-value: 3.07e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLrdCNTHDSLLEVCDDysldDNEYFFDRHPGAFTSILNFYRTGRL 104
Cdd:cd18362   2 VKLNVGGTYFLTTRTTLCRDPKSFLCRL--CQEDPDLPSDKDE----TGAYLIDRDPTYFGPILNYLRHGKL 67
BTB_POZ_KCNRG cd18375
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-124 6.51e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel regulatory protein (KCNRG); KCNRG, also called potassium channel regulator or protein CLLD4, is an endoplasmic reticulum (ER)-associated tumor suppressor that regulates Kv1 family potassium channel proteins by retaining a fraction of the channels in endomembranes. It contains a BTB/POZ domain, also known as tetramerization (T1) domain, which is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization.


Pssm-ID: 349684  Cd Length: 97  Bit Score: 39.71  E-value: 6.51e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDcntHDSllevcDDYSLDDNEYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18375   3 VTLNVGGKKFTTRPSTLRRFPDSRLARMLD---GKD-----QDFKVVNGQFFVDRDGSLFSYILDYLRTGQLTLPTEFSD 74
                        90
                ....*....|...
gi 4826784  113 -LSFSQELDYWGI 124
Cdd:cd18375  75 yNRLAREAEFYGL 87
BTB_POZ_KCTD6_like cd18365
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-104 7.38e-04

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing proteins, KCTD6, KCTD21 and similar proteins; KCTD6, also called KCASH3 (KCTD containing, Cullin3 adaptor, suppressor of Hedgehog 3), is a substrate-specific adaptor of cullin-3, effectively regulating protein levels of the muscle small ankyrin-1 isoform 5 (sAnk1.5). KCTD21, also called KCASH2, functions as a substrate-specific adaptor of cullin-3, promoting the ubiquitination and degradation of histone deacetylase HDAC1, thereby inhibiting the deacetylation-mediated transcriptional activation of the Hedgehog effectors Gli1 and Gli2. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization.


Pssm-ID: 349674  Cd Length: 94  Bit Score: 39.30  E-value: 7.38e-04
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDCN---THDsllevcddyslDDNEYFFDRHPGAFTSILNFYRTGRL 104
Cdd:cd18365   3 VNLNVGGVHYTTTLATLTRFPDSMLGAMFSGSmptTRD-----------DQGNYFIDRDGTLFRYILNFLRSSQL 66
BTB_POZ_KCTD1 cd18387
BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in ...
33-142 4.90e-03

BTB (Broad-Complex, Tramtrack and Bric a brac)/POZ (poxvirus and zinc finger) domain found in potassium channel tetramerization domain-containing protein 1 (KCTD1); KCTD1 is a nuclear BTB/POZ domain-containing protein that acts as a transcriptional repressor and mediates protein-protein interactions through a BTB domain. It represses the transcriptional activity of AP-2 family members, including TFAP2A, TFAP2B and TFAP2C to various extent. It also functions as a novel inhibitor of the Wnt signaling pathway. Mutations in KCTD1 cause scalp-ear-nipple (SEN) syndrome. The BTB/POZ domain, also known as tetramerization (T1) domain, is a versatile protein-protein interaction motif that facilitates homodimerization or heterodimerization. KCTD family BTB domains can adopt a wide range of oligomerization geometries, including homodimerization, tetramerization, and pentamerization. The KCTD1 BTB domains form pentamers.


Pssm-ID: 349695  Cd Length: 105  Bit Score: 37.29  E-value: 4.90e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4826784   33 VRLNVGGLAHEVLWRTLDRLPRTRLGKLRDcNTHDSLLEVCDDYslddneYFFDRHPGAFTSILNFYRTGRLHMMEEMCA 112
Cdd:cd18387   5 VHIDVGGHMYTSSLATLTKYPESRIGRLFD-GTEPIVLDSLKQH------YFIDRDGQMFRYILNFLRTSKLLIPDDFKD 77
                        90       100       110
                ....*....|....*....|....*....|.
gi 4826784  113 LS-FSQELDYWGIDEIYLEsccQARYHQKKE 142
Cdd:cd18387  78 YSlLYEEAKYFQLQPMLLE---LERWKQDRE 105
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.17
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH