NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4505981|ref|NP_002695.1|]
View 

platelet basic protein preproprotein [Homo sapiens]

Protein Classification

Chemokine_CXC domain-containing protein (domain architecture ID 10084510)

Chemokine_CXC domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
60-122 1.96e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


:

Pssm-ID: 238171  Cd Length: 64  Bit Score: 93.48  E-value: 1.96e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4505981   60 ELRCMCIKTTSG-IHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLA 122
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
 
Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
60-122 1.96e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238171  Cd Length: 64  Bit Score: 93.48  E-value: 1.96e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4505981   60 ELRCMCIKTTSG-IHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLA 122
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
60-119 3.31e-15

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 66.50  E-value: 3.31e-15
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4505981      60 ELRCmCIKTTS-GIHPKNIQSLEVIGkgTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQK 119
Cdd:smart00199   1 PLRC-CLSYTSkKIPLKRIKSYYPTS--SHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKK 58
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
62-119 3.87e-13

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 306544  Cd Length: 59  Bit Score: 61.03  E-value: 3.87e-13
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 4505981     62 RCmCIKTTSG-IHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQK 119
Cdd:pfam00048   2 DC-CLSYTSKkIPLKRIKSYRIQETSSSCPKPAVIFTTKKGRQVCADPKDKWVQKLMKK 59
 
Name Accession Description Interval E-value
Chemokine_CXC cd00273
Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
60-122 1.96e-25

Chemokine_CXC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; many members contain an RCxC motif which may be a general requirement for binding to CXC chemokine receptors; those with the ELR motif are chemotatic for neutrophils and have been shown to be angiogenic, while those without the motif act on T and B cells, and are typically angiostatic; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups.


Pssm-ID: 238171  Cd Length: 64  Bit Score: 93.48  E-value: 1.96e-25
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4505981   60 ELRCMCIKTTSG-IHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLA 122
Cdd:cd00273   1 ELRCRCIKTTSGfVHPKSIKKLEVIPPGPHCPNTEIIATLKNGRKVCLNPEAPWVQKIIKKLLK 64
Chemokine cd00169
Chemokine: small cytokines, including a number of secreted growth factors and interferons ...
65-121 9.76e-18

Chemokine: small cytokines, including a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; distinguished from other cytokines by their receptors, which are G-protein coupled receptors; divided into 4 subfamilies based on the arrangement of the two N-terminal cysteines; some members can bind multiple receptors and many chemokine receptors can bind more than one chemokine; this redundancy allows precise control in stimulating the immune system and in contributing to the homeostasis of a cell; when expressed inappropriately, chemokines play a role in autoimmune diseases, vascular irregularities, graft rejection, neoplasia, and allergies; exist as monomers, dimers and multimers, but are believed to function as monomers; found only in vertebrates and a few viruses. See CDs: Chemokine_CXC (cd00273), Chemokine_CC (cd00272), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for chemokine subgroups.


Pssm-ID: 238098  Cd Length: 59  Bit Score: 73.53  E-value: 9.76e-18
                        10        20        30        40        50
                ....*....|....*....|....*....|....*....|....*....|....*...
gi 4505981   65 CIKTTS-GIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKL 121
Cdd:cd00169   2 CLKYTSkPIPPKNIKSYRVQEAGGHCSIPAVIFTTKKGRKVCADPKEPWVKDLIQKLD 59
SCY smart00199
Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved ...
60-119 3.31e-15

Intercrine alpha family (small cytokine C-X-C) (chemokine CXC); Family of cytokines involved in cell-specific chemotaxis, mediation of cell growth, and the inflammatory response.


Pssm-ID: 197570  Cd Length: 59  Bit Score: 66.50  E-value: 3.31e-15
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4505981      60 ELRCmCIKTTS-GIHPKNIQSLEVIGkgTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQK 119
Cdd:smart00199   1 PLRC-CLSYTSkKIPLKRIKSYYPTS--SHCPKPAVIFTTKKGRKVCADPKAKWVQRYIKK 58
IL8 pfam00048
Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted ...
62-119 3.87e-13

Small cytokines (intecrine/chemokine), interleukin-8 like; Includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity. Structure contains two highly conserved disulfide bonds.


Pssm-ID: 306544  Cd Length: 59  Bit Score: 61.03  E-value: 3.87e-13
                          10        20        30        40        50
                  ....*....|....*....|....*....|....*....|....*....|....*....
gi 4505981     62 RCmCIKTTSG-IHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQK 119
Cdd:pfam00048   2 DC-CLSYTSKkIPLKRIKSYRIQETSSSCPKPAVIFTTKKGRQVCADPKDKWVQKLMKK 59
Chemokine_CC cd00272
Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal ...
72-119 8.66e-03

Chemokine_CC: 1 of 4 subgroup designations based on the arrangement of the two N-terminal cysteine residues; includes a number of secreted growth factors and interferons involved in mitogenic, chemotactic, and inflammatory activity; some members (e.g. 2HCC) contain an additional disulfide bond which is thought to compensate for the highly conserved Trp missing in these; chemotatic for monocytes, macrophages, eosinophils, basophils, and T cells, but not neutrophils; exist as monomers and dimers, but are believed to be functional as monomers; found only in vertebrates and a few viruses; a subgroup of CC, identified by an N-terminal DCCL motif (Exodus-1, Exodus-2, and Exodus-3), has been shown to inhibit specific types of human cancer cell growth in a mouse model. See CDs: Chemokine (cd00169) for the general alignment of chemokines, or Chemokine_CXC (cd00273), Chemokine_C (cd00271), and Chemokine_CX3C (cd00274) for the additional chemokine subgroups, and Chemokine_CC_DCCL for the DCCL subgroup of this CD.


Pssm-ID: 238170  Cd Length: 57  Bit Score: 32.60  E-value: 8.66e-03
                        10        20        30        40
                ....*....|....*....|....*....|....*....|....*...
gi 4505981   72 IHPKNIQSLEVIGkgTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQK 119
Cdd:cd00272  10 IPLRVLKSYRRTS--SSCSKPAVIFKTKRGREVCADPKQKWVQRYMKL 55
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH