NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|206597465|ref|NP_001128647.1|]
View 

protein NEDD1 isoform a [Homo sapiens]

Protein Classification

WD40 repeat domain-containing protein (domain architecture ID 10077586)

WD40 repeat domain-containing protein similar to a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
31-306 2.09e-51

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


:

Pssm-ID: 238121  Cd Length: 289  Bit Score: 181.38  E-value: 2.09e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  31 LVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVnLNSTSMYLVSGGLNNTVNI 110
Cdd:cd00200    1 LRRTLKGHTGG--VTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVA-ASADGTYLASGSSDKTIRL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 111 WDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPF-GHgsNQSVRHLKYSLFKKSLLGSvS 189
Cdd:cd00200   78 WDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLrGH--TDWVNSVAFSPDGTFVASS-S 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 190 DNGIVTLWDVNSQSPYHNFDSvHKAPASGICFSPVNELLFVTiGLDKRIILYDTSSKKLVKTLVADT-PLTAVDFMPDGA 268
Cdd:cd00200  155 QDGTIKLWDLRTGKCVATLTG-HTGEVNSVAFSPDGEKLLSS-SSDGTIKLWDLSTGKCLGTLRGHEnGVNSVAFSPDGY 232
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 206597465 269 TLAIGSSRGKIYQYDLRMlKSPVKTISAHKTSVQCIAF 306
Cdd:cd00200  233 LLASGSEDGTIRVWDLRT-GECVQTLSGHTNSVTSLAW 269
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
31-306 2.09e-51

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 181.38  E-value: 2.09e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  31 LVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVnLNSTSMYLVSGGLNNTVNI 110
Cdd:cd00200    1 LRRTLKGHTGG--VTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVA-ASADGTYLASGSSDKTIRL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 111 WDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPF-GHgsNQSVRHLKYSLFKKSLLGSvS 189
Cdd:cd00200   78 WDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLrGH--TDWVNSVAFSPDGTFVASS-S 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 190 DNGIVTLWDVNSQSPYHNFDSvHKAPASGICFSPVNELLFVTiGLDKRIILYDTSSKKLVKTLVADT-PLTAVDFMPDGA 268
Cdd:cd00200  155 QDGTIKLWDLRTGKCVATLTG-HTGEVNSVAFSPDGEKLLSS-SSDGTIKLWDLSTGKCLGTLRGHEnGVNSVAFSPDGY 232
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 206597465 269 TLAIGSSRGKIYQYDLRMlKSPVKTISAHKTSVQCIAF 306
Cdd:cd00200  233 LLASGSEDGTIRVWDLRT-GECVQTLSGHTNSVTSLAW 269
WD40 COG2319
WD40 repeat [General function prediction only];
10-285 1.29e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 104.40  E-value: 1.29e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  10 ENLRFASSGDD--IKIWDASSMTLVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQ 87
Cdd:COG2319  167 GKLLASGSSLDgtIKLWDLRTGKPLSTLAGHTDP--VSSLAFSPDGGLLIASGSSDGTIRLWDLSTGKLLRSTLSGHSDS 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  88 TCVNLNSTSMYLVSGGLNNTVNIWDLKS-KRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGH 166
Cdd:COG2319  245 VVSSFSPDGSLLASGSSDGTIRLWDLRSsSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTL 324
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 167 -GSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDsvHKAPASGICFSPvNELLFVTIGLDKRIILYDTSS 245
Cdd:COG2319  325 kGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLE--GHSNVLSVSFSP-DGRVVSSGSTDGTVRLWDLST 401
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 206597465 246 KKLVKTLVADT-PLTAVDFMPDGATLAIGSSRGKIYQYDLR 285
Cdd:COG2319  402 GSLLRNLDGHTsRVTSLDFSPDGKSLASGSSDNTIRLWDLK 442
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-316 2.25e-07

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 53.94  E-value: 2.25e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 180 FKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSvHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLT 259
Cdd:PLN00181 543 YIKSQVASSNFEGVVQVWDVARSQLVTEMKE-HEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANIC 621
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 206597465 260 AVDFMPD-GATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSS 316
Cdd:PLN00181 622 CVQFPSEsGRSLAFGSADHKVYYYDLRNPKLPLCTMIGHSKTVSYVRFVDSSTLVSSS 679
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
115-154 1.39e-03

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 38.45  E-value: 1.39e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 206597465   115 SKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHS 154
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
 
Name Accession Description Interval E-value
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
31-306 2.09e-51

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 181.38  E-value: 2.09e-51
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  31 LVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVnLNSTSMYLVSGGLNNTVNI 110
Cdd:cd00200    1 LRRTLKGHTGG--VTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVA-ASADGTYLASGSSDKTIRL 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 111 WDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPF-GHgsNQSVRHLKYSLFKKSLLGSvS 189
Cdd:cd00200   78 WDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKCLTTLrGH--TDWVNSVAFSPDGTFVASS-S 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 190 DNGIVTLWDVNSQSPYHNFDSvHKAPASGICFSPVNELLFVTiGLDKRIILYDTSSKKLVKTLVADT-PLTAVDFMPDGA 268
Cdd:cd00200  155 QDGTIKLWDLRTGKCVATLTG-HTGEVNSVAFSPDGEKLLSS-SSDGTIKLWDLSTGKCLGTLRGHEnGVNSVAFSPDGY 232
                        250       260       270
                 ....*....|....*....|....*....|....*...
gi 206597465 269 TLAIGSSRGKIYQYDLRMlKSPVKTISAHKTSVQCIAF 306
Cdd:cd00200  233 LLASGSEDGTIRVWDLRT-GECVQTLSGHTNSVTSLAW 269
WD40 COG2319
WD40 repeat [General function prediction only];
10-285 1.29e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 104.40  E-value: 1.29e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  10 ENLRFASSGDD--IKIWDASSMTLVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQ 87
Cdd:COG2319  167 GKLLASGSSLDgtIKLWDLRTGKPLSTLAGHTDP--VSSLAFSPDGGLLIASGSSDGTIRLWDLSTGKLLRSTLSGHSDS 244
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  88 TCVNLNSTSMYLVSGGLNNTVNIWDLKS-KRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGH 166
Cdd:COG2319  245 VVSSFSPDGSLLASGSSDGTIRLWDLRSsSSLLRTLSGHSSSVLSVAFSPDGKLLASGSSDGTVRLWDLETGKLLSSLTL 324
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 167 -GSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDsvHKAPASGICFSPvNELLFVTIGLDKRIILYDTSS 245
Cdd:COG2319  325 kGHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDLRTGKPLKTLE--GHSNVLSVSFSP-DGRVVSSGSTDGTVRLWDLST 401
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 206597465 246 KKLVKTLVADT-PLTAVDFMPDGATLAIGSSRGKIYQYDLR 285
Cdd:COG2319  402 GSLLRNLDGHTsRVTSLDFSPDGKSLASGSSDNTIRLWDLK 442
WD40 COG2319
WD40 repeat [General function prediction only];
10-316 5.23e-23

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 102.47  E-value: 5.23e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  10 ENLRFASSGDD--IKIWDASS-MTLVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQK 86
Cdd:COG2319  123 NSILLASSSLDgtVKLWDLSTpGKLIRTLEGHSES--VTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGHTDP 200
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  87 QTCVNLNSTS-MYLVSGGLNNTVNIWDLKS-KRVHRSLKDHKDQVtCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPF 164
Cdd:COG2319  201 VSSLAFSPDGgLLIASGSSDGTIRLWDLSTgKLLRSTLSGHSDSV-VSSFSPDGSLLASGSSDGTIRLWDLRSSSSLLRT 279
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 165 GHGSNQSVRHLKYSLFKKSLLgSVSDNGIVTLWDVNSQSPYHNFDSV-HKAPASGICFSPVNELLFVTIGLDKRIILYDT 243
Cdd:COG2319  280 LSGHSSSVLSVAFSPDGKLLA-SGSSDGTVRLWDLETGKLLSSLTLKgHEGPVSSLSFSPDGSLLVSGGSDDGTIRLWDL 358
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|...
gi 206597465 244 SSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSpVKTISAHKTSVQCIAFQYSTVLTKSS 316
Cdd:COG2319  359 RTGKPLKTLEGHSNVLSVSFSPDGRVVSSGSTDGTVRLWDLSTGSL-LRNLDGHTSRVTSLDFSPDGKSLASG 430
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
15-152 9.23e-18

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 84.31  E-value: 9.23e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  15 ASSGDD--IKIWDASSMTLVDKFNPHTSPhgISSICWSSNNNFLVTASSSGDKIV--VSSCKCkpvplLELAEGQKQ--T 88
Cdd:cd00200  151 ASSSQDgtIKLWDLRTGKCVATLTGHTGE--VNSVAFSPDGEKLLSSSSDGTIKLwdLSTGKC-----LGTLRGHENgvN 223
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 206597465  89 CVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIIL 152
Cdd:cd00200  224 SVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSPDGKRLASGSADGTIRI 287
WD40 COG2319
WD40 repeat [General function prediction only];
99-319 1.62e-13

WD40 repeat [General function prediction only];


Pssm-ID: 225201  Cd Length: 466  Bit Score: 73.20  E-value: 1.62e-13
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  99 LVSGGLNNTVNIWDLKSKRvhrsLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTN---LSSTPFGHGSNQSVRHL 175
Cdd:COG2319   42 LLALLSDSLVSLPDLSSLL----LRGHEDSITSIAFSPDGELLLSGSSDGTIKLWDLDNGeklIKSLEGLHDSSVSKLAL 117
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 176 KYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVAD 255
Cdd:COG2319  118 SSPDGNSILLASSSLDGTVKLWDLSTPGKLIRTLEGHSESVTSLAFSPDGKLLASGSSLDGTIKLWDLRTGKPLSTLAGH 197
                        170       180       190       200       210       220
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
gi 206597465 256 T-PLTAVDFMPDGATLAIGSSR-GKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNK 319
Cdd:COG2319  198 TdPVSSLAFSPDGGLLIASGSSdGTIRLWDLSTGKLLRSTLSGHSDSVVSSFSPDGSLLASGSSDG 263
WD40 cd00200
WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions ...
11-112 1.12e-07

WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment.


Pssm-ID: 238121  Cd Length: 289  Bit Score: 53.88  E-value: 1.12e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465  11 NLRFASSGDD--IKIWDASSMTLVDKFNPHTSPhgISSICWSSNNNFLVTASSSGdKIVV-SSCKCKPVplLELAEGQKQ 87
Cdd:cd00200  189 GEKLLSSSSDgtIKLWDLSTGKCLGTLRGHENG--VNSVAFSPDGYLLASGSEDG-TIRVwDLRTGECV--QTLSGHTNS 263
                         90       100
                 ....*....|....*....|....*.
gi 206597465  88 -TCVNLNSTSMYLVSGGLNNTVNIWD 112
Cdd:cd00200  264 vTSLAWSPDGKRLASGSADGTIRIWD 289
PLN00181 PLN00181
protein SPA1-RELATED; Provisional
180-316 2.25e-07

protein SPA1-RELATED; Provisional


Pssm-ID: 177776  Cd Length: 793  Bit Score: 53.94  E-value: 2.25e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 206597465 180 FKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSvHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLT 259
Cdd:PLN00181 543 YIKSQVASSNFEGVVQVWDVARSQLVTEMKE-HEKRVWSIDYSSADPTLLASGSDDGSVKLWSINQGVSIGTIKTKANIC 621
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
gi 206597465 260 AVDFMPD-GATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSS 316
Cdd:PLN00181 622 CVQFPSEsGRSLAFGSADHKVYYYDLRNPKLPLCTMIGHSKTVSYVRFVDSSTLVSSS 679
WD40 smart00320
WD40 repeats; Note that these repeats are permuted with respect to the structural repeats ...
115-154 1.39e-03

WD40 repeats; Note that these repeats are permuted with respect to the structural repeats (blades) of the beta propeller domain.


Pssm-ID: 197651  Cd Length: 40  Bit Score: 38.45  E-value: 1.39e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|
gi 206597465   115 SKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHS 154
Cdd:smart00320   1 SGELLKTLKGHTGPVTSVAFSPDGKYLASGSDDGTIKLWD 40
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH