NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|28178861|ref|NP_000577.2|]
View 

interleukin-2 precursor [Homo sapiens]

Protein Classification

IL2 domain-containing protein (domain architecture ID 10464987)

IL2 domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
IL2 pfam00715
Interleukin 2;
7-150 1.64e-73

Interleukin 2;


:

Pssm-ID: 279104  Cd Length: 145  Bit Score: 219.22  E-value: 1.64e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28178861     7 LSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPL 86
Cdd:pfam00715   1 LSCIALTLALVANSAPTSSSTKETQQQLEQLLLDLQLLLEGVNNYKNPKLSRMLTFKFYMPKKATELKHLQCLEEELKPL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 28178861    87 EEVLNLAQSKNFHLR-PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS 150
Cdd:pfam00715  81 EEVLNLAQSKNFHLKdTKEFISNINVTVLKLKGSETTFTCEYDDETATIVEFLNKWITFCQSIIS 145
 
Name Accession Description Interval E-value
IL2 pfam00715
Interleukin 2;
7-150 1.64e-73

Interleukin 2;


Pssm-ID: 279104  Cd Length: 145  Bit Score: 219.22  E-value: 1.64e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28178861     7 LSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPL 86
Cdd:pfam00715   1 LSCIALTLALVANSAPTSSSTKETQQQLEQLLLDLQLLLEGVNNYKNPKLSRMLTFKFYMPKKATELKHLQCLEEELKPL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 28178861    87 EEVLNLAQSKNFHLR-PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS 150
Cdd:pfam00715  81 EEVLNLAQSKNFHLKdTKEFISNINVTVLKLKGSETTFTCEYDDETATIVEFLNKWITFCQSIIS 145
IL2 smart00189
Interleukin-2 family; Interleukin-2 is a cytokine produced by T-helper cells in response to ...
1-153 6.65e-65

Interleukin-2 family; Interleukin-2 is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. This protein is required for T-cell proliferation and other activities crucial to the regulation of the immune response.


Pssm-ID: 128486  Cd Length: 154  Bit Score: 197.79  E-value: 6.65e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28178861      1 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE 80
Cdd:smart00189   1 MYKIQLLSCIALTLALLTNSAPTSSSTKSTQQHLEQLLLDLQLLLEGVENPENLKLPRMLTFKFYLPKQATELKHLQCLE 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 28178861     81 EELKPLEEVLNLAQSKNFHLR-PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT 153
Cdd:smart00189  81 EELKPLEEVLDLAQSKNFQLEhIKDFISNINVTVLKLKGSETRFTCQYDDESVTIVEFLNRWIAFCQSIISTLT 154
 
Name Accession Description Interval E-value
IL2 pfam00715
Interleukin 2;
7-150 1.64e-73

Interleukin 2;


Pssm-ID: 279104  Cd Length: 145  Bit Score: 219.22  E-value: 1.64e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28178861     7 LSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLEEELKPL 86
Cdd:pfam00715   1 LSCIALTLALVANSAPTSSSTKETQQQLEQLLLDLQLLLEGVNNYKNPKLSRMLTFKFYMPKKATELKHLQCLEEELKPL 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 28178861    87 EEVLNLAQSKNFHLR-PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIIS 150
Cdd:pfam00715  81 EEVLNLAQSKNFHLKdTKEFISNINVTVLKLKGSETTFTCEYDDETATIVEFLNKWITFCQSIIS 145
IL2 smart00189
Interleukin-2 family; Interleukin-2 is a cytokine produced by T-helper cells in response to ...
1-153 6.65e-65

Interleukin-2 family; Interleukin-2 is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. This protein is required for T-cell proliferation and other activities crucial to the regulation of the immune response.


Pssm-ID: 128486  Cd Length: 154  Bit Score: 197.79  E-value: 6.65e-65
                           10        20        30        40        50        60        70        80
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 28178861      1 MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE 80
Cdd:smart00189   1 MYKIQLLSCIALTLALLTNSAPTSSSTKSTQQHLEQLLLDLQLLLEGVENPENLKLPRMLTFKFYLPKQATELKHLQCLE 80
                           90       100       110       120       130       140       150
                   ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 28178861     81 EELKPLEEVLNLAQSKNFHLR-PRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNRWITFCQSIISTLT 153
Cdd:smart00189  81 EELKPLEEVLDLAQSKNFQLEhIKDFISNINVTVLKLKGSETRFTCQYDDESVTIVEFLNRWIAFCQSIISTLT 154
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH