NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4557757|ref|NP_000240.1|]
View 

DNA mismatch repair protein Mlh1 isoform 1 [Homo sapiens]

Protein Classification

MutL_Trans_MLH1 and Mlh1_C domain-containing protein (domain architecture ID 11489359)

MutL_Trans_MLH1 and Mlh1_C domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
mutl TIGR00585
DNA mismatch repair protein MutL; All proteins in this family for which the functions are ...
6-315 8.30e-142

DNA mismatch repair protein MutL; All proteins in this family for which the functions are known are involved in the process of generalized mismatch repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


:

Pssm-ID: 273155  Cd Length: 312  Bit Score: 423.21  E-value: 8.30e-142
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757      6 GVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKL 85
Cdd:TIGR00585   1 MTIKPLPPELVNKIAAGEVIERPASVVKELVENSLDAGATRIDVEIEEGGLKLIEVSDNGSGIDKEDLPLACERHATSKI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     86 QSFEDLASISTYGFRGEALASISHVAHVTITTKT-ADGKCAYRASYsDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK 164
Cdd:TIGR00585  81 QSFEDLERIETLGFRGEALASISSVSRLTITTKTsAADGLAYQALL-EGGMIESIKPAPRPVGTTVEVRDLFYNLPVRRK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    165 ALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDN-IRSIFGNAVSRELIEIGcEDKTLAFKMN 243
Cdd:TIGR00585 160 FLKSPKKEFRKILDVLQRYALIHPDISFSLTHDGKKVLQLSTKPNQSTKENrIRSVFGTAVLRKLIPLD-EWEDLDLQLE 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557757    244 GYISNANYSVKKCI--FLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVH 315
Cdd:TIGR00585 239 GFISQPNVTRSRRSgwQFLFINGRPVELKLLLKAIREVYHEYLPKGQYPVFVLNLEIDPELVDVNVHPDKKEVR 312
Mlh1_C pfam16413
DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch ...
502-756 3.66e-138

DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch repair protein Mlh1, these proteins belong to the MutL family. This domain forms part of the endonuclease active site.


:

Pssm-ID: 318596  Cd Length: 251  Bit Score: 411.12  E-value: 3.66e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    502 NLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAP 581
Cdd:pfam16413   1 RLTSIKELRKEVEESMHKGLTEIFKNHTFVGCVDERLALIQHGTKLYLVDYGALSEELFYQLGLRDFGNFGRIRLSPPLP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    582 LFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLA 661
Cdd:pfam16413  81 LYELLELALESEESGWTEEDGPKEELAEKIVELLIEKAEMLEEYFSIEIDEDGNLESLPLLLKGYTPNLDKLPLFLLRLA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    662 TEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEvpgSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGnIL 741
Cdd:pfam16413 161 TEVDWEDEKECFETILRELALFYAPEPLPPPKDEDDEDSEIE---ARREEWKWVIEHVLFPAIKRRLLPPKSLLKDT-VV 236
                         250
                  ....*....|....*
gi 4557757    742 QLANLPDLYKVFERC 756
Cdd:pfam16413 237 QVANLPDLYKVFERC 251
 
Name Accession Description Interval E-value
mutl TIGR00585
DNA mismatch repair protein MutL; All proteins in this family for which the functions are ...
6-315 8.30e-142

DNA mismatch repair protein MutL; All proteins in this family for which the functions are known are involved in the process of generalized mismatch repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273155  Cd Length: 312  Bit Score: 423.21  E-value: 8.30e-142
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757      6 GVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKL 85
Cdd:TIGR00585   1 MTIKPLPPELVNKIAAGEVIERPASVVKELVENSLDAGATRIDVEIEEGGLKLIEVSDNGSGIDKEDLPLACERHATSKI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     86 QSFEDLASISTYGFRGEALASISHVAHVTITTKT-ADGKCAYRASYsDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK 164
Cdd:TIGR00585  81 QSFEDLERIETLGFRGEALASISSVSRLTITTKTsAADGLAYQALL-EGGMIESIKPAPRPVGTTVEVRDLFYNLPVRRK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    165 ALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDN-IRSIFGNAVSRELIEIGcEDKTLAFKMN 243
Cdd:TIGR00585 160 FLKSPKKEFRKILDVLQRYALIHPDISFSLTHDGKKVLQLSTKPNQSTKENrIRSVFGTAVLRKLIPLD-EWEDLDLQLE 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557757    244 GYISNANYSVKKCI--FLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVH 315
Cdd:TIGR00585 239 GFISQPNVTRSRRSgwQFLFINGRPVELKLLLKAIREVYHEYLPKGQYPVFVLNLEIDPELVDVNVHPDKKEVR 312
Mlh1_C pfam16413
DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch ...
502-756 3.66e-138

DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch repair protein Mlh1, these proteins belong to the MutL family. This domain forms part of the endonuclease active site.


Pssm-ID: 318596  Cd Length: 251  Bit Score: 411.12  E-value: 3.66e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    502 NLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAP 581
Cdd:pfam16413   1 RLTSIKELRKEVEESMHKGLTEIFKNHTFVGCVDERLALIQHGTKLYLVDYGALSEELFYQLGLRDFGNFGRIRLSPPLP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    582 LFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLA 661
Cdd:pfam16413  81 LYELLELALESEESGWTEEDGPKEELAEKIVELLIEKAEMLEEYFSIEIDEDGNLESLPLLLKGYTPNLDKLPLFLLRLA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    662 TEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEvpgSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGnIL 741
Cdd:pfam16413 161 TEVDWEDEKECFETILRELALFYAPEPLPPPKDEDDEDSEIE---ARREEWKWVIEHVLFPAIKRRLLPPKSLLKDT-VV 236
                         250
                  ....*....|....*
gi 4557757    742 QLANLPDLYKVFERC 756
Cdd:pfam16413 237 QVANLPDLYKVFERC 251
MutL COG0323
DNA mismatch repair ATPase MutL [Replication, recombination and repair];
8-687 6.84e-135

DNA mismatch repair ATPase MutL [Replication, recombination and repair];


Pssm-ID: 223400  Cd Length: 638  Bit Score: 417.13  E-value: 6.84e-135
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    8 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:COG0323   4 IRQLPPDLVNQIAAGEVIERPASVVKELVENSLDAGATRIDIEVEGGGLKLIRVRDNGSGIDKEDLPLALLRHATSKIAS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   88 FEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALK 167
Cdd:COG0323  84 LEDLFRIRTLGFRGEALASIASVSRLTITSRTAEASEGTQIYAEGGGMEVTVKPAAHPVGTTVEVRDLFYNTPARRKFLK 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  168 NPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDN-IRSIFGNAVSRELIEIgcEDKTLAFKMNGYI 246
Cdd:COG0323 164 SEKTEFGHITELINRYALAHPDISFSLSHNGKLRIELLKLPGTGDLEErIAAVYGTEFLKNALPI--ENEHEDLRLSGYV 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  247 SNANYSVKKCIFL-LFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILER 325
Cdd:COG0323 242 SLPEFTRASRDYQyLFVNGRPVRDKLLNHALREAYADYLPRGRYPVFVLFLELDPELVDVNVHPAKKEVRFSDERLVHDL 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  326 VQQHIESkllgsnssrmYFTQTllpglagpsgemvksttsltssstsgssDKVYAHQMVRTDSREQKLDAFLQPLSKPLS 405
Cdd:COG0323 322 IYEAIKE----------ALAQQ----------------------------GLIPPASVEAPKSASQPLPAFQEPSPLPES 363
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  406 SQPQAIVTEDKTDISSGrarqqdeemlelPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDD 485
Cdd:COG0323 364 RIQKSKVAKSGSSKSDA------------PSIAEPASGASPSPASPSIRPLSKNILPESSPGSLKNEDRSYDDLLEEPAE 431
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  486 SRKEmtaactprrriinltsvlslQEEINEQGHEVLREMLhnHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILI 565
Cdd:COG0323 432 SEDK--------------------QEEAEQKAISEDVFPL--GEAIGQVHGTYILAEHEDGLVLVDQHAAHERILYEKLK 489
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  566 YDFANFGVL-RLSEPApLFDLamlaldspesgwTEEDgpkeglAEYIVEFLKKKAEMladYFSLEIDEEGNLI--GLPLL 642
Cdd:COG0323 490 NELGNVGELqPLLIPI-RLEL------------SPEE------ADVLEEHKEELEKL---GFEIESFGENSVAvrSVPAM 547
                       650       660       670       680
                ....*....|....*....|....*....|....*....|....*
gi 4557757  643 IDNYvpPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIR 687
Cdd:COG0323 548 LGKA--EVQELIRELLDDLLEGKLKDLKELLEELAATMACRSAVK 590
mutL PRK00095
DNA mismatch repair protein; Reviewed
8-427 6.99e-112

DNA mismatch repair protein; Reviewed


Pssm-ID: 234630  Cd Length: 617  Bit Score: 356.06  E-value: 6.99e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     8 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:PRK00095   3 IQLLPPQLANQIAAGEVVERPASVVKELVENALDAGATRIDIEIEEGGLKLIRVRDNGCGISKEDLALALARHATSKIAS 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    88 FEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKaPPKPCAGNQGTQITVEDLFYNIATRRKALK 167
Cdd:PRK00095  83 LDDLEAIRTLGFRGEALPSIASVSRLTLTSRTADAAEGWQIVYEGGEIV-EVKPAAHPVGTTIEVRDLFFNTPARRKFLK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   168 NPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVadVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDktLAFKMNGYI- 246
Cdd:PRK00095 162 SEKTELGHIDDVVNRLALAHPDVAFTLTHNGKLV--LQTRGAGQLLQRLAAILGREFAENALPIDAEH--GDLRLSGYVg 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   247 ------SNANYsvkkcIFlLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEE 320
Cdd:PRK00095 238 lptlsrANRDY-----QY-LFVNGRYVRDKLLNHAIRQAYHDLLPRGRYPAFVLFLELDPHQVDVNVHPAKHEVRFRDER 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   321 SILERVQQHIESKLLGSN----------------SSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMV 384
Cdd:PRK00095 312 LVHDLIVQAIQEALAQSGlipaaaganqvlepaePEPLPLQQTPLYASGSSPPASSPSSAPPEQSEESQEESSAEKNPLQ 391
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 4557757   385 RTDSREQKLDAFLQPLSK--PLSSQPQAIVTEDKTDISSGRARQQ 427
Cdd:PRK00095 392 PNASQSEAAAAASAEAAAaaPAAAPEPAEAAEEADSFPLGYALGQ 436
MutL_Trans_MLH1 cd03483
MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
211-335 5.82e-73

MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1). This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. MLH1 forms heterodimers with PMS2, PMS1 and MLH3. These three complexes have distinct functions in meiosis. hMLH1-hPMS2 also participates in the repair of all DNA mismatch repair (MMR) substrates. Roles for hMLH1-hPMS1 or hMLH1-hMLH3 in MMR have not been established. Cells lacking hMLH1 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hMLH1 causes predisposition to HNPCC, Muir-Torre syndrome and Turcot syndrome (HNPCC variant). Mutation in hMLH1 accounts for a large fraction of HNPCC families.


Pssm-ID: 239565  Cd Length: 127  Bit Score: 235.98  E-value: 5.82e-73
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  211 STVDNIRSIFGNAVSRELIEIGCEDKT--LAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNT 288
Cdd:cd03483   1 STKDNIRSVYGAAVANELIEVEISDDDddLGFKVKGLISNANYSKKKIIFILFINNRLVECSALRRAIENVYANYLPKGA 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 4557757  289 HPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLL 335
Cdd:cd03483  81 HPFVYLSLEIPPENVDVNVHPTKREVHFLNEEEIIERIQKLVEDKLS 127
DNA_mis_repair pfam01119
DNA mismatch repair protein, C-terminal domain; This family represents the C-terminal domain ...
217-334 2.05e-40

DNA mismatch repair protein, C-terminal domain; This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold.


Pssm-ID: 307324  Cd Length: 117  Bit Score: 145.71  E-value: 2.05e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    217 RSIFGNAVSRELIEIGCEDKTlaFKMNGYISNANYS-VKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLS 295
Cdd:pfam01119   1 AAIYGKEFAKNLLPIEKEDDD--LRLSGYISKPELSrSNRDYQYLFVNGRPVRDKLLSHAIREAYRDLLPKGRYPVAVLF 78
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 4557757    296 LEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL 334
Cdd:pfam01119  79 LEIDPELVDVNVHPTKREVRFSDEREVYDFIYEAVREAL 117
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
31-87 1.95e-04

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 41.87  E-value: 1.95e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757      31 AIKEMIENCLDAKSTSIQVIV---KEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVtleRDGDHVEITVEDNGPGIPPEDLEKIFEPFFRTDKRS 68
 
Name Accession Description Interval E-value
mutl TIGR00585
DNA mismatch repair protein MutL; All proteins in this family for which the functions are ...
6-315 8.30e-142

DNA mismatch repair protein MutL; All proteins in this family for which the functions are known are involved in the process of generalized mismatch repair. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]


Pssm-ID: 273155  Cd Length: 312  Bit Score: 423.21  E-value: 8.30e-142
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757      6 GVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKL 85
Cdd:TIGR00585   1 MTIKPLPPELVNKIAAGEVIERPASVVKELVENSLDAGATRIDVEIEEGGLKLIEVSDNGSGIDKEDLPLACERHATSKI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     86 QSFEDLASISTYGFRGEALASISHVAHVTITTKT-ADGKCAYRASYsDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRK 164
Cdd:TIGR00585  81 QSFEDLERIETLGFRGEALASISSVSRLTITTKTsAADGLAYQALL-EGGMIESIKPAPRPVGTTVEVRDLFYNLPVRRK 159
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    165 ALKNPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDN-IRSIFGNAVSRELIEIGcEDKTLAFKMN 243
Cdd:TIGR00585 160 FLKSPKKEFRKILDVLQRYALIHPDISFSLTHDGKKVLQLSTKPNQSTKENrIRSVFGTAVLRKLIPLD-EWEDLDLQLE 238
                         250       260       270       280       290       300       310
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557757    244 GYISNANYSVKKCI--FLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVH 315
Cdd:TIGR00585 239 GFISQPNVTRSRRSgwQFLFINGRPVELKLLLKAIREVYHEYLPKGQYPVFVLNLEIDPELVDVNVHPDKKEVR 312
Mlh1_C pfam16413
DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch ...
502-756 3.66e-138

DNA mismatch repair protein Mlh1 C-terminus; This is the C-terminal domain of DNA mismatch repair protein Mlh1, these proteins belong to the MutL family. This domain forms part of the endonuclease active site.


Pssm-ID: 318596  Cd Length: 251  Bit Score: 411.12  E-value: 3.66e-138
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    502 NLTSVLSLQEEINEQGHEVLREMLHNHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAP 581
Cdd:pfam16413   1 RLTSIKELRKEVEESMHKGLTEIFKNHTFVGCVDERLALIQHGTKLYLVDYGALSEELFYQLGLRDFGNFGRIRLSPPLP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    582 LFDLAMLALDSPESGWTEEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLA 661
Cdd:pfam16413  81 LYELLELALESEESGWTEEDGPKEELAEKIVELLIEKAEMLEEYFSIEIDEDGNLESLPLLLKGYTPNLDKLPLFLLRLA 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    662 TEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEvpgSIPNSWKWTVEHIVYKALRSHILPPKHFTEDGnIL 741
Cdd:pfam16413 161 TEVDWEDEKECFETILRELALFYAPEPLPPPKDEDDEDSEIE---ARREEWKWVIEHVLFPAIKRRLLPPKSLLKDT-VV 236
                         250
                  ....*....|....*
gi 4557757    742 QLANLPDLYKVFERC 756
Cdd:pfam16413 237 QVANLPDLYKVFERC 251
MutL COG0323
DNA mismatch repair ATPase MutL [Replication, recombination and repair];
8-687 6.84e-135

DNA mismatch repair ATPase MutL [Replication, recombination and repair];


Pssm-ID: 223400  Cd Length: 638  Bit Score: 417.13  E-value: 6.84e-135
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    8 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:COG0323   4 IRQLPPDLVNQIAAGEVIERPASVVKELVENSLDAGATRIDIEVEGGGLKLIRVRDNGSGIDKEDLPLALLRHATSKIAS 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   88 FEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALK 167
Cdd:COG0323  84 LEDLFRIRTLGFRGEALASIASVSRLTITSRTAEASEGTQIYAEGGGMEVTVKPAAHPVGTTVEVRDLFYNTPARRKFLK 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  168 NPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVADVRTLPNASTVDN-IRSIFGNAVSRELIEIgcEDKTLAFKMNGYI 246
Cdd:COG0323 164 SEKTEFGHITELINRYALAHPDISFSLSHNGKLRIELLKLPGTGDLEErIAAVYGTEFLKNALPI--ENEHEDLRLSGYV 241
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  247 SNANYSVKKCIFL-LFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILER 325
Cdd:COG0323 242 SLPEFTRASRDYQyLFVNGRPVRDKLLNHALREAYADYLPRGRYPVFVLFLELDPELVDVNVHPAKKEVRFSDERLVHDL 321
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  326 VQQHIESkllgsnssrmYFTQTllpglagpsgemvksttsltssstsgssDKVYAHQMVRTDSREQKLDAFLQPLSKPLS 405
Cdd:COG0323 322 IYEAIKE----------ALAQQ----------------------------GLIPPASVEAPKSASQPLPAFQEPSPLPES 363
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  406 SQPQAIVTEDKTDISSGrarqqdeemlelPAPAEVAAKNQSLEGDTTKGTSEMSEKRGPTSSNPRKRHREDSDVEMVEDD 485
Cdd:COG0323 364 RIQKSKVAKSGSSKSDA------------PSIAEPASGASPSPASPSIRPLSKNILPESSPGSLKNEDRSYDDLLEEPAE 431
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  486 SRKEmtaactprrriinltsvlslQEEINEQGHEVLREMLhnHSFVGCVNPQWALAQHQTKLYLLNTTKLSEELFYQILI 565
Cdd:COG0323 432 SEDK--------------------QEEAEQKAISEDVFPL--GEAIGQVHGTYILAEHEDGLVLVDQHAAHERILYEKLK 489
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  566 YDFANFGVL-RLSEPApLFDLamlaldspesgwTEEDgpkeglAEYIVEFLKKKAEMladYFSLEIDEEGNLI--GLPLL 642
Cdd:COG0323 490 NELGNVGELqPLLIPI-RLEL------------SPEE------ADVLEEHKEELEKL---GFEIESFGENSVAvrSVPAM 547
                       650       660       670       680
                ....*....|....*....|....*....|....*....|....*
gi 4557757  643 IDNYvpPLEGLPIFILRLATEVNWDEEKECFESLSKECAMFYSIR 687
Cdd:COG0323 548 LGKA--EVQELIRELLDDLLEGKLKDLKELLEELAATMACRSAVK 590
mutL PRK00095
DNA mismatch repair protein; Reviewed
8-427 6.99e-112

DNA mismatch repair protein; Reviewed


Pssm-ID: 234630  Cd Length: 617  Bit Score: 356.06  E-value: 6.99e-112
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     8 IRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:PRK00095   3 IQLLPPQLANQIAAGEVVERPASVVKELVENALDAGATRIDIEIEEGGLKLIRVRDNGCGISKEDLALALARHATSKIAS 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    88 FEDLASISTYGFRGEALASISHVAHVTITTKTADGKCAYRASYSDGKLKaPPKPCAGNQGTQITVEDLFYNIATRRKALK 167
Cdd:PRK00095  83 LDDLEAIRTLGFRGEALPSIASVSRLTLTSRTADAAEGWQIVYEGGEIV-EVKPAAHPVGTTIEVRDLFFNTPARRKFLK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   168 NPSEEYGKILEVVGRYSVHNAGISFSVKKQGETVadVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDktLAFKMNGYI- 246
Cdd:PRK00095 162 SEKTELGHIDDVVNRLALAHPDVAFTLTHNGKLV--LQTRGAGQLLQRLAAILGREFAENALPIDAEH--GDLRLSGYVg 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   247 ------SNANYsvkkcIFlLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEE 320
Cdd:PRK00095 238 lptlsrANRDY-----QY-LFVNGRYVRDKLLNHAIRQAYHDLLPRGRYPAFVLFLELDPHQVDVNVHPAKHEVRFRDER 311
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   321 SILERVQQHIESKLLGSN----------------SSRMYFTQTLLPGLAGPSGEMVKSTTSLTSSSTSGSSDKVYAHQMV 384
Cdd:PRK00095 312 LVHDLIVQAIQEALAQSGlipaaaganqvlepaePEPLPLQQTPLYASGSSPPASSPSSAPPEQSEESQEESSAEKNPLQ 391
                        410       420       430       440
                 ....*....|....*....|....*....|....*....|....*
gi 4557757   385 RTDSREQKLDAFLQPLSK--PLSSQPQAIVTEDKTDISSGRARQQ 427
Cdd:PRK00095 392 PNASQSEAAAAASAEAAAaaPAAAPEPAEAAEEADSFPLGYALGQ 436
MutL_Trans_MLH1 cd03483
MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
211-335 5.82e-73

MutL_Trans_MLH1: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH1 (MutL homologue 1). This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. MLH1 forms heterodimers with PMS2, PMS1 and MLH3. These three complexes have distinct functions in meiosis. hMLH1-hPMS2 also participates in the repair of all DNA mismatch repair (MMR) substrates. Roles for hMLH1-hPMS1 or hMLH1-hMLH3 in MMR have not been established. Cells lacking hMLH1 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hMLH1 causes predisposition to HNPCC, Muir-Torre syndrome and Turcot syndrome (HNPCC variant). Mutation in hMLH1 accounts for a large fraction of HNPCC families.


Pssm-ID: 239565  Cd Length: 127  Bit Score: 235.98  E-value: 5.82e-73
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  211 STVDNIRSIFGNAVSRELIEIGCEDKT--LAFKMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNT 288
Cdd:cd03483   1 STKDNIRSVYGAAVANELIEVEISDDDddLGFKVKGLISNANYSKKKIIFILFINNRLVECSALRRAIENVYANYLPKGA 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|....*..
gi 4557757  289 HPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKLL 335
Cdd:cd03483  81 HPFVYLSLEIPPENVDVNVHPTKREVHFLNEEEIIERIQKLVEDKLS 127
MutL_Trans cd00782
MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the ...
214-334 5.47e-44

MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. Included in this group are proteins similar to human MLH1, hPMS2, hPMS1, hMLH3 and E. coli MutL, MLH1 forms heterodimers with PMS2, PMS1 and MLH3. These three complexes have distinct functions in meiosis. hMLH1-hPMS2 also participates in the repair of all DNA mismatch repair (MMR) substrates. Roles for hMLH1-hPMS1 or hMLH1-hMLH3 in MMR have not been established. Cells lacking either hMLH1 or hPMS2 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hMLH1 causes predisposition to HNPCC, Muir-Torre syndrome and Turcot syndrome (HNPCC variant). Mutation in hPMS2 causes predisposition to HPNCC and Turcot syndrome. Mutation in hMLH1 accounts for a large fraction of HNPCC families. There is no convincing evidence to support hPMS1 having a role in HNPCC predisposition. It has been suggested that hMLH3 may be a low risk gene for colorectal cancer; however there is little evidence to support it having a role in classical HNPCC. It has been suggested that during initiation of DNA mismatch repair in E. coli, the mismatch recognition protein MutS recruits MutL in the presence of ATP. The MutS(ATP)-MutL ternary complex formed, then recruits the latent endonuclease MutH.


Pssm-ID: 238405  Cd Length: 122  Bit Score: 155.78  E-value: 5.47e-44
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  214 DNIRSIFGNAVSRELIEIGCEDKTlaFKMNGYISNANYSV-KKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFL 292
Cdd:cd00782   3 DRIAQVYGKEVAKNLIEVELESGD--FRISGYISKPDFGRsSKDRQFLFVNGRPVRDKLLSKAINEAYRSYLPKGRYPVF 80
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 4557757  293 YLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL 334
Cdd:cd00782  81 VLNLELPPELVDVNVHPTKREVRFSDEEEVLELIREALRSAL 122
DNA_mis_repair pfam01119
DNA mismatch repair protein, C-terminal domain; This family represents the C-terminal domain ...
217-334 2.05e-40

DNA mismatch repair protein, C-terminal domain; This family represents the C-terminal domain of the mutL/hexB/PMS1 family. This domain has a ribosomal S5 domain 2-like fold.


Pssm-ID: 307324  Cd Length: 117  Bit Score: 145.71  E-value: 2.05e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    217 RSIFGNAVSRELIEIGCEDKTlaFKMNGYISNANYS-VKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLS 295
Cdd:pfam01119   1 AAIYGKEFAKNLLPIEKEDDD--LRLSGYISKPELSrSNRDYQYLFVNGRPVRDKLLSHAIREAYRDLLPKGRYPVAVLF 78
                          90       100       110
                  ....*....|....*....|....*....|....*....
gi 4557757    296 LEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL 334
Cdd:pfam01119  79 LEIDPELVDVNVHPTKREVRFSDEREVYDFIYEAVREAL 117
TopoII_MutL_Trans cd00329
MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the ...
214-315 7.16e-22

MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. The GyrB dimerizes in response to ATP binding, and is homologous to the N-terminal half of eukaryotic Topo II and the ATPase fragment of MutL. Type II DNA topoisomerases catalyze the ATP-dependent transport of one DNA duplex through another, in the process generating transient double strand breaks via covalent attachments to both DNA strands at the 5' positions. Included in this group are proteins similar to human MLH1 and PMS2. MLH1 forms a heterodimer with PMS2 which functions in meiosis and in DNA mismatch repair (MMR). Cells lacking either hMLH1 or hPMS2 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hMLH1 accounts for a large fraction of Lynch syndrome (HNPCC) families.


Pssm-ID: 238202  Cd Length: 107  Bit Score: 93.09  E-value: 7.16e-22
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  214 DNIRSIFGNAVSRELIEIGCEDKTlaFKMNGYISNANYSV-KKCIFLLFINHRLV-ESTSLRKAIETVYAAYL---PKNT 288
Cdd:cd00329   3 DRLAEILGDKVADKLIYVEGESDG--FRVEGAISYPDSGRsSKDRQFSFVNGRPVrEGGTHVKAVREAYTRALngdDVRR 80
                        90       100
                ....*....|....*....|....*..
gi 4557757  289 HPFLYLSLEISPQNVDVNVHPTKHEVH 315
Cdd:cd00329  81 YPVAVLSLKIPPSLVDVNVHPTKEEVR 107
MutL_Trans_MutL cd03482
MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
216-334 4.24e-14

MutL_Trans_MutL: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to Escherichia coli MutL. EcMutL belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from the ATP-binding site to the DNA breakage/reunion regions of the enzymes. It has been suggested that during initiation of DNA mismatch repair in E. coli, the mismatch recognition protein MutS recruits MutL in the presence of ATP. The MutS(ATP)-MutL ternary complex formed, then recruits the latent endonuclease MutH. Prokaryotic MutS and MutL are homodimers.


Pssm-ID: 239564  Cd Length: 123  Bit Score: 71.08  E-value: 4.24e-14
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  216 IRSIFGNAVSRELIEIGCEDKTLafKMNGYISNANYS-VKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYL 294
Cdd:cd03482   5 LADILGEDFAEQALAIDEEAGGL--RLSGWIALPTFArSQADIQYFYVNGRMVRDKLISHAVRQAYSDVLHGGRHPAYVL 82
                        90       100       110       120
                ....*....|....*....|....*....|....*....|
gi 4557757  295 SLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL 334
Cdd:cd03482  83 YLELDPAQVDVNVHPAKHEVRFRDSRLVHDFIYHAVKKAL 122
MutL_Trans_hPMS_2_like cd03484
MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
214-332 3.08e-12

MutL_Trans_hPMS2_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM2 (hPSM2). hPSM2 belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. Included in this group are proteins similar to yeast PMS1. The yeast MLH1-PMS1 and the human MLH1-PMS2 heterodimers play a role in meiosis. hMLH1-hPMS2 also participates in the repair of all DNA mismatch repair (MMR) substrates. Cells lacking hPMS2 have a strong mutator phenotype and display microsatellite instability (MSI). Mutation in hPMS2 causes predisposition to HPNCC and Turcot syndrome.


Pssm-ID: 239566  Cd Length: 142  Bit Score: 66.14  E-value: 3.08e-12
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  214 DNIRSIFGNAVSRELIEI---------------GCEDKTLAFKMNGYISnanysvkKCIF----------LLFINHRLVE 268
Cdd:cd03484   4 DNIINVFGGKVIKGLIPInleldvnptkeeldsDEDLADSEVKITGYIS-------KPSHgcgrsssdrqFFYINGRPVD 76
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 4557757  269 STSLRKAIETVYAAYlPKNTHPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIES 332
Cdd:cd03484  77 LKKVAKLINEVYKSF-NSRQYPFFILNISLPTSLYDVNVTPDKRTVLLHDEDRLIDTLKTSLSE 139
MutL_Trans_hPMS_1_like cd03485
MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
218-332 1.87e-09

MutL_Trans_hPMS1_like: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to human PSM1 (hPSM1) and yeast MLH2. hPSM1 and yMLH2 are members of the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. PMS1 forms a heterodimer with MLH1. The MLH1-PMS1 complex functions in meiosis. Loss of yMLH2 results in a small but significant decrease in spore viability and a significant increase in gene conversion frequencies. A role for hMLH1-hPMS1 in DNA mismatch repair has not been established. Mutation in hMLH1 accounts for a large fraction of Lynch syndrome (HNPCC) families, however there is no convincing evidence to support hPMS1 having a role in HNPCC predisposition.


Pssm-ID: 239567  Cd Length: 132  Bit Score: 57.28  E-value: 1.87e-09
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  218 SIFGNAVSRELIEIGCEDKTLAFKMNGYI--SNANYSVKKCIF-LLFINHRLVESTS-LRKAIETVYAAYLPKNT---HP 290
Cdd:cd03485   8 RVLGTAVAANMVPVQSTDEDPQISLEGFLpkPGSDVSKTKSDGkFISVNSRPVSLGKdIGKLLRQYYSSAYRKSSlrrYP 87
                        90       100       110       120
                ....*....|....*....|....*....|....*....|..
gi 4557757  291 FLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIES 332
Cdd:cd03485  88 VFFLNILCPPGLVDVNIEPDKDDVLLQNKEAVLQAVENLLES 129
HATPase_c_3 pfam13589
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents, additionally, ...
31-132 6.06e-08

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents, additionally, the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 316143  Cd Length: 136  Bit Score: 52.70  E-value: 6.06e-08
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757     31 AIKEMIENCLDAKSTSIQVIVKEGGLKL-IQIQDNGTGIRKEDLDIVCeRFTTSKLQSFEDLASISTYGFrGEALASISH 109
Cdd:pfam13589   6 ALAELVDNSLDADATNVKIEVNKNRTGGeIVIEDDGHGMSEEELINAL-RLATPDKEAERGSTDLGRKGI-GLKLASLSL 83
                          90       100
                  ....*....|....*....|...
gi 4557757    110 VAHVTITTKTADGKCAYRASYSD 132
Cdd:pfam13589  84 GRKLTVTTKKEGESSTVTLDRDW 106
HATPase_c cd00075
Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: ...
31-122 7.44e-08

Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins


Pssm-ID: 238030  Cd Length: 103  Bit Score: 52.26  E-value: 7.44e-08
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757   31 AIKEMIENCLDA---KSTSIQVIVKEGGLKL-IQIQDNGTGIRKEDLDIVCERfttsklqsFEDLASISTYGFRGEALAS 106
Cdd:cd00075   4 VLLNLLSNAIKHtpeGGGRITISVERDGDHLeIRVEDNGPGIPEEDLERIFER--------FSDGSRSRKGGGTGLGLSI 75
                        90       100
                ....*....|....*....|.
gi 4557757  107 ISHVA-----HVTITTKTADG 122
Cdd:cd00075  76 VKKLVelhggRIEVESEPGGG 96
HATPase_c pfam02518
Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the ...
31-89 2.91e-06

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; This family represents the structurally related ATPase domains of histidine kinase, DNA gyrase B and HSP90.


Pssm-ID: 308236  Cd Length: 109  Bit Score: 47.36  E-value: 2.91e-06
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 4557757     31 AIKEMIENCLD-AKSTSIQVIVK-EGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQSFE 89
Cdd:pfam02518   9 VLSNLLDNALKhAKAGEITVTLSaDGGDLELTVEDNGIGIPPEDLPRIFEPFSTSSKRGGG 69
HATPase_c smart00387
Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.
31-87 1.95e-04

Histidine kinase-like ATPases; Histidine kinase-, DNA gyrase B-, phytochrome-like ATPases.


Pssm-ID: 214643  Cd Length: 111  Bit Score: 41.87  E-value: 1.95e-04
                           10        20        30        40        50        60
                   ....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757      31 AIKEMIENCLDAKSTSIQVIV---KEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSKLQS 87
Cdd:smart00387   9 VLSNLLDNAIKYTPEGGRITVtleRDGDHVEITVEDNGPGIPPEDLEKIFEPFFRTDKRS 68
BaeS COG0642
Signal transduction histidine kinase [Signal transduction mechanisms];
5-84 3.41e-03

Signal transduction histidine kinase [Signal transduction mechanisms];


Pssm-ID: 223715  Cd Length: 336  Bit Score: 40.12  E-value: 3.41e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757    5 AGVIRRLDETVVNRIAAGEviQRPANAIKEMIENCLDA-KSTSIQVIVKEGGLKL-IQIQDNGTGIRKEDLDIVCERFTT 82
Cdd:COG0642 208 KGIELAVDLPELPYVLGDP--ERLRQVLVNLLSNAIKYtPGGEITISVRQDDEQVtISVEDTGPGIPEEELERIFEPFFR 285

                ..
gi 4557757   83 SK 84
Cdd:COG0642 286 TD 287
MutL_Trans_MLH3 cd03486
MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in ...
217-334 4.48e-03

MutL_Trans_MLH3: transducer domain, having a ribosomal S5 domain 2-like fold, found in proteins similar to yeast and human MLH3 (MutL homologue 3). MLH3 belongs to the DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is known to be important in nucleotide hydrolysis and the transduction of structural signals from ATP-binding site to the DNA breakage/reunion regions of the enzymes. MLH1 forms heterodimers with MLH3. The MLH1-MLH3 complex plays a role in meiosis. A role for hMLH1-hMLH3 in DNA mismatch repair (MMR) has not been established. It has been suggested that hMLH3 may be a low risk gene for colorectal cancer; however there is little evidence to support it having a role in classical HNPCC.


Pssm-ID: 239568  Cd Length: 141  Bit Score: 38.07  E-value: 4.48e-03
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557757  217 RSIFGNAVSRELIEIGCEDKTlaFKMNGYISNaNYSVKKCIFLLFINHRLVESTSLRKAIETVY----AAYLPKNT---- 288
Cdd:cd03486   7 KQIYGLVLAQKLKEVSAKFQE--YEVSGYISS-EGHYSKSFQFIYVNGRLYLKTRFHKLINKLFrktsAVAKNKSSpqsk 83
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*..
gi 4557757  289 -----------HPFLYLSLEISPQNVDVNVHPTKHEVHFLHEESILERVQQHIESKL 334
Cdd:cd03486  84 ssrrgkrsqesYPVFVLNITCPASEYDLSQEPSKTIIEFKDWKTLLPLILEVVKSFL 140
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH