NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|4557715|ref|NP_000221.1|]
View 

leptin precursor [Homo sapiens]

Protein Classification

Leptin domain-containing protein (domain architecture ID 10488393)

Leptin domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Leptin pfam02024
Leptin;
26-167 1.92e-89

Leptin;


:

Pssm-ID: 280242  Cd Length: 142  Bit Score: 260.05  E-value: 1.92e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557715     26 KVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLR 105
Cdd:pfam02024   1 KVQDDTKTLIKTIITRINDISHTQSVSSKQKVTGLDFIPGLHPLLSLSKMDQTLAVYQQILSSLPSRNMTQISNDLENLR 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4557715    106 DLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC 167
Cdd:pfam02024  81 SLLHLLATSKGCPLPQTSGLETLENLGGTLEASLYSTEVVALSRLQKSLLEMLRQLDLIKGC 142
 
Name Accession Description Interval E-value
Leptin pfam02024
Leptin;
26-167 1.92e-89

Leptin;


Pssm-ID: 280242  Cd Length: 142  Bit Score: 260.05  E-value: 1.92e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557715     26 KVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLR 105
Cdd:pfam02024   1 KVQDDTKTLIKTIITRINDISHTQSVSSKQKVTGLDFIPGLHPLLSLSKMDQTLAVYQQILSSLPSRNMTQISNDLENLR 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4557715    106 DLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC 167
Cdd:pfam02024  81 SLLHLLATSKGCPLPQTSGLETLENLGGTLEASLYSTEVVALSRLQKSLLEMLRQLDLIKGC 142
 
Name Accession Description Interval E-value
Leptin pfam02024
Leptin;
26-167 1.92e-89

Leptin;


Pssm-ID: 280242  Cd Length: 142  Bit Score: 260.05  E-value: 1.92e-89
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 4557715     26 KVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLR 105
Cdd:pfam02024   1 KVQDDTKTLIKTIITRINDISHTQSVSSKQKVTGLDFIPGLHPLLSLSKMDQTLAVYQQILSSLPSRNMTQISNDLENLR 80
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 4557715    106 DLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC 167
Cdd:pfam02024  81 SLLHLLATSKGCPLPQTSGLETLENLGGTLEASLYSTEVVALSRLQKSLLEMLRQLDLIKGC 142
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH