NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|149064702|gb|EDM14853|]
View 

rCG50107, isoform CRA_a [Rattus norvegicus]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
7tm_GPCRs super family cl28897
seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary ...
23-306 2.64e-150

seven-transmembrane G protein-coupled receptor superfamily; This hierarchical evolutionary model represents the seven-transmembrane (7TM) receptors, often referred to as G protein-coupled receptors (GPCRs), which transmit physiological signals from the outside of the cell to the inside via G proteins. GPCRs constitute the largest known superfamily of transmembrane receptors across the three kingdoms of life that respond to a wide variety of extracellular stimuli including peptides, lipids, neurotransmitters, amino acids, hormones, and sensory stimuli such as light, smell and taste. All GPCRs share a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. However, some 7TM receptors, such as the type 1 microbial rhodopsins, do not activate G proteins. Based on sequence similarity, GPCRs can be divided into six major classes: class A (the rhodopsin-like family), class B (the Methuselah-like, adhesion and secretin-like receptor family), class C (the metabotropic glutamate receptor family), class D (the fungal mating pheromone receptors), class E (the cAMP receptor family), and class F (the frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


The actual alignment was detected with superfamily member cd15149:

Pssm-ID: 355774  Cd Length: 284  Bit Score: 423.87  E-value: 2.64e-150
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15149    1 RVIPVFYSLVFIVGILLNGVNFWIFFYVPSNKSFIVYLKNIVFADLLMSLTFPFKILSDVELGPWQLNVIVCRYSAVIFY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15149   81 LNMYVGIIFFGLIGFDRYYKIVKPLHTSFVQNVGYSKALSVVVWMLMAVLSVPNIILTNQSFHEANYTKCARLKSELGIQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15149  161 WHKASNYICVSIFWVVFLLLIIFYVAISRKIYKSNQKFRRNSTNMKAKSSRNIFSILFVFFVCFVPYHALRIPYTLSQTG 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15149  241 ADYSCQSKTILYYMKEFTLLLSAANVCLDPIIYFFLCQPFREML 284
 
Name Accession Description Interval E-value
7tmA_P2Y14 cd15149
P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled ...
23-306 2.64e-150

P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y14 receptor is activated by UDP-sugars and belongs to the G(i) class of the P2Y family of purinergic G-protein coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-sugars (P2Y14). P2Y14 receptor has been reported to be involved in a diverse set of physiological responses in many epithelia as well as in immune and inflammatory cells.


Pssm-ID: 320277  Cd Length: 284  Bit Score: 423.87  E-value: 2.64e-150
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15149    1 RVIPVFYSLVFIVGILLNGVNFWIFFYVPSNKSFIVYLKNIVFADLLMSLTFPFKILSDVELGPWQLNVIVCRYSAVIFY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15149   81 LNMYVGIIFFGLIGFDRYYKIVKPLHTSFVQNVGYSKALSVVVWMLMAVLSVPNIILTNQSFHEANYTKCARLKSELGIQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15149  161 WHKASNYICVSIFWVVFLLLIIFYVAISRKIYKSNQKFRRNSTNMKAKSSRNIFSILFVFFVCFVPYHALRIPYTLSQTG 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15149  241 ADYSCQSKTILYYMKEFTLLLSAANVCLDPIIYFFLCQPFREML 284
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
40-295 1.18e-26

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 105.85  E-value: 1.18e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702   40 NGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGL-TFPFKVLSDSGlGPWQLNVFVCRVSAVIFYVNMYVSIAFFGLISF 117
Cdd:pfam00001   2 NLLVILVILRNKKLRTpTNIFLLNLAVADLLFLLlTLPFWLVYYLH-GTWPFGSALCKLVTFLDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  118 DRYYKIVKPLLVSivQSVNYSKVLSVLVWVLMLLLAVPNIILTNQ-SVKDVTNIQCMELKNElgRKWHKASN-YVFVSIF 195
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTlDIPSNGVTSCLITFPE--SLWPVSYLlFSTVLGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  196 WIVFLLLTVFYMAITRKIFKsHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCQAKETLLY 275
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRK-QQSSSIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIISCEVVTPPRT 235
                         250       260
                  ....*....|....*....|
gi 149064702  276 TKEFTLLLSAANVCLDPIIY 295
Cdd:pfam00001 236 LLQLTVWLAYSNSCLNPIIY 255
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
24-315 4.87e-25

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 102.93  E-value: 4.87e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKvLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:PHA03087  42 ILIVVYSTIFFFGLVGNIIVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQ-IYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELkNELGRKW 183
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFY-NNKTMNW 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSI-FWIVFLLLTVFYMAITRKIFKSHLKSRknsisvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:PHA03087 200 KLFINFEINIIgMLIPLTILLYCYSKILITLKGINKSKK------NKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILH 273
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLRMSLT 315
Cdd:PHA03087 274 FKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKSLKLMFT 326
 
Name Accession Description Interval E-value
7tmA_P2Y14 cd15149
P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled ...
23-306 2.64e-150

P2Y purinoceptor 14, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y14 receptor is activated by UDP-sugars and belongs to the G(i) class of the P2Y family of purinergic G-protein coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-sugars (P2Y14). P2Y14 receptor has been reported to be involved in a diverse set of physiological responses in many epithelia as well as in immune and inflammatory cells.


Pssm-ID: 320277  Cd Length: 284  Bit Score: 423.87  E-value: 2.64e-150
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15149    1 RVIPVFYSLVFIVGILLNGVNFWIFFYVPSNKSFIVYLKNIVFADLLMSLTFPFKILSDVELGPWQLNVIVCRYSAVIFY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15149   81 LNMYVGIIFFGLIGFDRYYKIVKPLHTSFVQNVGYSKALSVVVWMLMAVLSVPNIILTNQSFHEANYTKCARLKSELGIQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15149  161 WHKASNYICVSIFWVVFLLLIIFYVAISRKIYKSNQKFRRNSTNMKAKSSRNIFSILFVFFVCFVPYHALRIPYTLSQTG 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15149  241 ADYSCQSKTILYYMKEFTLLLSAANVCLDPIIYFFLCQPFREML 284
7tmA_P2Y12-like cd15924
P2Y purinoceptors 12, 13, 14, and similar proteins, member of the class A family of ...
23-306 8.89e-131

P2Y purinoceptors 12, 13, 14, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y12-like receptors as well as closely related orphan receptor, GPR87.


Pssm-ID: 341352  Cd Length: 284  Bit Score: 374.48  E-value: 8.89e-131
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15924    1 QLFPVLYTVIFFAGILLNGLAMWIFFHIPSKSSFIIYLKNTVVADLLMILTFPFKILSDAGLGPWQLRTFVCRVTSVLFY 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15924   81 FTMYTSIVFLGLISIDRYLKIVRPFKTSFPKSVSFAKILSVVVWALMFLLSLPNMILTNQQPREKNVKKCSFLKSELGLK 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15924  161 WHEIVNYICQVIFWIVFLLMIVCYTAITKKVYRSYRRVFRSSSSRRKKSNVKIFIIVAVFFVCFVPYHFARIPYTLSQTR 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15924  241 DVFDCTAENILFYVKEATLFLSALNVCLDPIIYFFLCKSFRESL 284
7tmA_P2Y13 cd15151
P2Y purinoceptor 13, member of the class A family of seven-transmembrane G protein-coupled ...
24-306 1.38e-98

P2Y purinoceptor 13, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y13 receptor (P2Y13R) is activated by adenosine diphosphate (ADP) and belongs to the G(i) class of the P2Y family of purinergic G protein-coupled receptors. P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-sugars (P2Y14).


Pssm-ID: 341327  Cd Length: 284  Bit Score: 292.46  E-value: 1.38e-98
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15151    2 VFPVLYTVLFLVGLILNSVAAWIFFHIPSTSTFIVYLKNTLVADLIMTLMLPFKILSDSGLGPWQLRAFVCRFSAVVFYI 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKW 183
Cdd:cd15151   82 TMYISIILLGLISFDRYLKIVRPFGKSWVQRVRFAKILSGAVWLVMFLLSVPNMILSNKPATPISVKKCASLKSPLGLKW 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEG 263
Cdd:cd15151  162 HEVVNYICQFIFWGVFALMVLFYTIISKKVYESYKKSRSKDNKASKKTKAKVFIIVAVFFVCFAPFHFVRVPYTLSQTGK 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 149064702 264 HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15151  242 ITDCQLQNLLYIAKEITLWLAATNVCLDPLIYIFLCKSFRQRL 284
7tmA_GPR87 cd15969
G protein-coupled receptor 87, member of the class A family of seven-transmembrane G ...
24-306 3.00e-91

G protein-coupled receptor 87, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR87 acts as one of multiple receptors for lysophosphatidic acid (LPA). This orphan receptor has been shown to be overexpressed in several malignant tumors including lung squamous cell carcinoma and regulated by p53. GPR87 is phylogenetically closely related to the G(i) class of the P2Y family of purinergic G protein-coupled receptors. P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase.


Pssm-ID: 320635  Cd Length: 283  Bit Score: 273.97  E-value: 3.00e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15969    2 VFPVLYLIIFIGSILLNGLAVWIFFHIRNKTSFIFYLKNIVIADLLMTLTFPFKIIQDSGLGPWNFNFFLCRYTSVLFYA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKW 183
Cdd:cd15969   82 SMYTSIVFLGLISLDRYLKVVKPFGDSRMYSITFTKVLSACVWLIMAFLSLPNIILTNGQPTEDNIHDCSKLKSPLGVKW 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHlKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEG 263
Cdd:cd15969  162 HTAVSYINICIFVAVLVILIVCYISISRYIYKSS-KQFISSSSRTRKHNQSIRVVVAVFFVCFLPYHLCRIPFTFSQLDK 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 149064702 264 HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15969  241 ILDCTIKTILYYCKEATLFLSACNVCLDPIIYFFMCRSFSQRL 283
7tmA_P2Y12 cd15150
P2Y purinoceptor 12, member of the class A family of seven-transmembrane G protein-coupled ...
24-306 2.50e-83

P2Y purinoceptor 12, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y12 receptor (P2Y12R) is found predominantly on the surface of blood platelets and is activated by adenosine diphosphate (ADP). P2Y12R plays an important role in the regulation of blood clotting and belongs to the G(i) class of the P2Y family of purinergic G protein-coupled receptors. P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-sugars. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-sugars (P2Y14).


Pssm-ID: 341326  Cd Length: 285  Bit Score: 253.58  E-value: 2.50e-83
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15150    2 IFPLLYTVLFIVGLTMNGLAMRVFFQIPSKSNFIIFLKNTVISDLLMILTFPFKILSDAKLGSWPLRGFVCQVTSVIFYF 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKW 183
Cdd:cd15150   82 TMYISILFLGLITIDRYQKTTRPFKTSNPKNLLGAKILSTVIWASMFALSLPNMILTNRQPTPKNVKKCSLLKSEFGLVW 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEG 263
Cdd:cd15150  162 HEIVNYICQVIFWVNFLIVIVCYTLITKELYKSYKRTRGVGKVSRKKVNVKVFIIIAVFFICFVPFHFARIPYTLSQTRD 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 149064702 264 HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15150  242 VFDCTAKNTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSL 284
7tmA_purinoceptor-like cd14982
purinoceptor and its related proteins, member of the class A family of seven-transmembrane G ...
23-303 2.45e-70

purinoceptor and its related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; Members of this subfamily include lysophosphatidic acid receptor, P2 purinoceptor, protease-activated receptor, platelet-activating factor receptor, Epstein-Barr virus induced gene 2, proton-sensing G protein-coupled receptors, GPR35, and GPR55, among others. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 341318 [Multi-domain]  Cd Length: 283  Bit Score: 220.21  E-value: 2.45e-70
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFF-YVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd14982    1 TLFPIVYSLIFILGLLGNILALWVFLrKMKKRSPTTIYMINLALADLLFVLTLPFRIYYYLNGGWWPFGDFLCRLTGLLF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGR 181
Cdd:cd14982   81 YINMYGSILFLTCISVDRYLAVVHPLKSRRLRRKRYAVGVCAGVWILVLVASVPLLLLRSTIAKENNSTTCFEFLSEWLA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNsiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd14982  161 SAAPIVLIALVVGFLIPLLIILVCYSLIIRALRRRSKQSQKS--VRKRKALRMILIVLAVFLVCFLPYHVTRILYLLVRL 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 262 EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd14982  239 SFIADCSARNSLYKAYRITLCLASLNSCLDPLIYYFLSKTFR 280
7tmA_GPR171 cd15167
orphan G protein-coupled receptor 171, member of the class A family of seven-transmembrane G ...
28-303 2.58e-59

orphan G protein-coupled receptor 171, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR171 is phylogenetically related to the P2Y family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. A recent study has been reported that the peptide LENSSPQAPARRLLPP (BigLEN) activates GPR17 to regulate body weight in mice; however the biological role of the receptor remains unknown. GPR171 is a member of the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A common feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. G-proteins regulate a variety of cellular functions including metabolic enzymes, ion channels, and transporters, among many others.


Pssm-ID: 320295  Cd Length: 282  Bit Score: 191.90  E-value: 2.58e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMY 106
Cdd:cd15167    6 FYYLIFLIGFIGSCFALWAFIQKRSSRKCInIYLINLLTADFLLTLALPVKIAVDLGIAPWKLKIFHCQVTACLIYINMY 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 107 VSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKWHKA 186
Cdd:cd15167   86 LSIIFLGFVSIDRYLQLTHSSKLYRIQEPGFAKMISAVVWTLVLFIMVPNMAIPIKTIEEKPGVGCADFKTEFGRHWHVL 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 187 SNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSIsvkRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYS 266
Cdd:cd15167  166 TNFICMAIFLNFSAIILISNFLVIRKLYRNKDSEEYRNA---RQALVNILLVTAGYVICFVPYHIVRIPYTLSQSEVITD 242
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 149064702 267 CQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15167  243 CSLKRSLFLAKESTLLLAVLNLCFDPILYFHLSKAFR 279
7tmA_GPR34-like cd15920
P2Y-like receptor and similar proteins, member of the class A family of seven-transmembrane G ...
25-303 2.85e-50

P2Y-like receptor and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR34 is phylogenetically related to the P2Y family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. GPR34 is shown to couple to G(i/o) protein and is highly expressed in microglia. Recently, lysophosphatidylserine has been identified as a ligand for GPR34. This group belongs to the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, which then activate the heterotrimeric G proteins. G-proteins regulate a variety of cellular functions including metabolic enzymes, ion channels, and transporters, among many others.


Pssm-ID: 320586  Cd Length: 278  Bit Score: 168.44  E-value: 2.85e-50
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSK-SFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPwqlnVFVCRVSAVIFYV 103
Cdd:cd15920    3 LPVMYSIICIVGLLSNTLALWVFFLRQQREtSISVYMRNLALADLLLVLCLPFRVAYQNTAGP----LSFCKIVGAFFYL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQsvKDVTNIQCMELKNElgRKW 183
Cdd:cd15920   79 NMYASILFLSLISLDRYLKIIKPLQQFKIHTVPWSSAASGGVWLLLLACMIPFLFESRN--EGPCDNKCFHFRSK--GLT 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSIsvKRKSSRNI---FSIVLVFVVCFVPYHIARIPYTKSQ 260
Cdd:cd15920  155 AGGINLTAVVIFYILSLLFLYFYAKISHKLYKVSLGNAQQQI--KKASKRAIiktFIVLAIFIVCFVPYHIVRVPYVLAQ 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 149064702 261 TEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15920  233 IDVISSLPWKQTLHIANELVLCLSALNSCLDPIIYFFLSSSFR 275
7tmA_GPR34-like cd15148
putative G protein-coupled receptor 34, member of the class A family of seven-transmembrane G ...
28-305 1.19e-46

putative G protein-coupled receptor 34, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 34 of unknown function. Orphan GPR34 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320276  Cd Length: 282  Bit Score: 159.09  E-value: 1.19e-46
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMY 106
Cdd:cd15148    6 FYSLIFLFGLVGNLLALWVFLFIHRKRNSVrIFLINVAIADLLLIICLPFRILYHVNNNQWTLGPLLCKVVGNLFYMNMY 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 107 VSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTnqsVKDVTNIQCMELKNELGRKWHKA 186
Cdd:cd15148   86 ISIILLGFISLDRYLKINRSSRRQKFLTRKWSIVACGVLWAVALVGFVPMIVLT---EKNEESTKCFQYKDRKNAKGKAI 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 187 SNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVK-RKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHy 265
Cdd:cd15148  163 FNFLIVAMFWLVFLLLILSYGKIAKKLLRISRDKPDFPNAAKyNRTARKSFFVLFIFTVCFVPYHAFRIFYITSQLQNN- 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 149064702 266 SCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREV 305
Cdd:cd15148  242 SCYWKEILHKTNEIMLLLSAFNSCLDPVMYFLLSSSIRKV 281
7tmA_GPR17 cd15161
G protein-coupled receptor 17, member of the class A family of seven-transmembrane G ...
29-306 2.38e-41

G protein-coupled receptor 17, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR17 is a Forkhead box protein O1 (FOXO1) target and abundantly expressed in agouti-related peptide (AGRP) neurons. FOXO1 is a transcription factor that plays key roles in regulation of gluconeogenesis and glycogenolysis by insulin signaling. For instance, food intake and body weight increase when hypothalamic FOXO1 is activated, whereas they both decrease when FOXO1 is inhibited. However, a recent study has been reported that GPR17 deficiency in mice did not affect food intake or glucose homeostasis. Thus, GPR17 may not play a role in the control of food intake, body weight, or glycemic control. GPR17 is phylogenetically closely related to purinergic P2Y and cysteinyl-leukotriene receptors.


Pssm-ID: 320289 [Multi-domain]  Cd Length: 277  Bit Score: 145.24  E-value: 2.38e-41
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  29 YCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMYV 107
Cdd:cd15161    7 YILVFILAFPGNTLALWLFIHDRKSGTpSNVFLMHLAVADLSYVLILPMRLVYHLSGNHWPFGEVPCRLAGFLFYLNMYA 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 108 SIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQSVKDVTNIQCMELKNElgrkwhKAS 187
Cdd:cd15161   87 SLYFLACISVDRFLAIVHPVKSMKIRKPLYAHVVCGFLWVIVTVAMAP-LLVSPQTVEVNNTTVCLQLYRE------KAS 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 188 NYVFVSI---FWIVFLLLTVFYMAITRKIFKSHLKSRKnsisVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGH 264
Cdd:cd15161  160 RGALVSLavaFTIPFVTTVTCYLLIIRSLRTGKREEKP----LKDKAIKMIILVLTIFLICFVPYHISRYIYILSHNGAG 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 265 YSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15161  236 ASCSSRRGLALANRITSCLTCLNGALDPVMYFFVAEKFRETL 277
7tmA_PAFR cd15147
platelet-activating factor receptor, member of the class A family of seven-transmembrane G ...
26-306 4.72e-38

platelet-activating factor receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; The platelet-activating factor receptor is a G(q/11)-protein coupled receptor, which is linked to p38 MAPK and PI3K signaling pathways. PAF is a phospholipid (1-0-alkyl-2-acetyl-sn-glycero-3-phosphorylcholine) which is synthesized by cells especially involved in host defense such as platelets, macrophages, neutrophils, and monocytes. PAF is well-known for its ability to induce platelet aggregation and anaphylaxis, and also plays important roles in allergy, asthma, and inflammatory responses, among many others.


Pssm-ID: 320275  Cd Length: 291  Bit Score: 137.19  E-value: 4.72e-38
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  26 PMLYCVVFITGVLLNGISGWIFFYVPSSKSF---IIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15147    4 PIVYSIIFVLGLIANCYVLWVFARLYPSKKLneiKIFMVNLTIADLLFLITLPFWIVYYHNEGNWILPKFLCNVAGCLFF 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIIL--TNQSVKDVTNIQ-CMELKNEL 179
Cdd:cd15147   84 INTYCSVAFLGVISYNRYQAVTRPIKTAQSTTRKRGIIISVAIWVIIVASASYFLFMdsTNTVKIDSGNFTrCFEGYEKD 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 180 GRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKS 259
Cdd:cd15147  164 NSKPVLIIHFIIIGLFFLVFLLILVCNLVIARTLLSQPVQGQRNA-GVKRRALWMVCTVLAVFVICFVPHHVVQGPWTLA 242
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 149064702 260 --QTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15147  243 vlQQWRYWDCQFRQALNDAHQITLCLMSTNCVLDPVIYCFLTKKFRKHL 291
7tmA_CysLTR1 cd15158
cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G ...
23-306 3.40e-32

cysteinyl leukotriene receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320286  Cd Length: 285  Bit Score: 121.39  E-value: 3.40e-32
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd15158    1 QVYSTLYSVITVFGLVGNGFALYVLIKTYRQKSaFHIYMLNLAVSDLLCVCTLPLRVVYYVHKGQWLFGDFLCRISSYAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPllVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTN-IQCMELKNELG 180
Cdd:cd15158   81 YVNLYCSIYFMTAMSFTRFLAIVFP--VQNLNLVTVKKARIVCVGIWIFVTLTSSPFLMSGSHDTETNkTKCFEPPQSNQ 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 181 RKWH-KASNYV-FVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTK 258
Cdd:cd15158  159 QLTKlLVLNYIsLVVGFIIPFLVILICYAMIIRTLLKNTMKARKQQ-SSRKKAIRMIIIVLLAFLVSFMPYHIQRTIHLH 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 149064702 259 SQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15158  238 FLSRKDSTCEEVLYMQKSVVITLCLAAANCCFDPLLYFFSGENFRRRL 285
7tmA_CysLTR2 cd15157
cysteinyl leukotriene receptor 2, member of the class A family of seven-transmembrane G ...
24-306 1.21e-29

cysteinyl leukotriene receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320285  Cd Length: 278  Bit Score: 114.42  E-value: 1.21e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYvPSSK--SFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd15157    2 IYPTVYLIIFVLGVVGNGLSIYVFLQ-PSKKktSVNIFMLNLAVSDLMFVSTLPFRADYYLMGSHWVFGDIACRIMSYSL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPniILTNQSVKDVTNIQCMELKNELGR 181
Cdd:cd15157   81 YVNMYCSIYFLTVLSIVRFLAIVHPFKLWKVTSIKYARILCAVIWIFVMAASSP--LLSKGTSKYNSQTKCLDLHPSKID 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKrKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15157  159 KLLILNYIVLVVGFILPFCTLSICYILIIKALLKPRVPQSKLRVSHK-KALLTIIITLILFLLCFLPYHILRTVHLMQWS 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 149064702 262 EGHYSCQAKETLLytkeFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15157  238 EGQCNLRLHKAVV----ITLCLAAANSCLDPLLYYFAGENFKERL 278
7tmA_EBI2 cd15159
Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G ...
24-304 1.54e-29

Epstein-Barr virus (EBV)-induced gene 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Epstein-Barr virus-induced G-protein coupled receptor 2 (EBI2), also called GPR183, is activated by 7alpha, 25-dihydroxyxcholesterol (7alpha, 25-OHC), an oxysterol. EBI2 was originally identified as one of major genes induced in the Burkitt's lymphoma cell line BL41by EBV infection. EBI2 is involved in regulating B cell migration and responses, and is also implicated in human diseases such as type I diabetes, multiple sclerosis, and cancers.


Pssm-ID: 320287  Cd Length: 286  Bit Score: 114.37  E-value: 1.54e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISgwifFYVPSSK-----SFIIYLKNIVVADFLMGLTFPFKVlSDSGLG-PWQLNVFVCRVS 97
Cdd:cd15159    2 LLPLFYSLILVFGLLGNTLA----LHVICQKrkkinSTTLYLINLAVSDILFTLALPGRI-AYYALGfDWPFGDWLCRLT 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  98 AVIFYVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNII--LTNQSVKDVTniqCMEL 175
Cdd:cd15159   77 ALLFYINTYAGVNFMTCLSVDRYIAVVHPLRRHRLRKVKVVRYICVFVWVLVFLQTLPLLFmpMTKEMGGRIT---CMEY 153
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 176 KNelgrkWHKASNYVFVSI------FWIVFLLLTVFYMAITRKIFKShlkSRKNSISVK----RKSSRNIFSIVLVFVVC 245
Cdd:cd15159  154 PN-----FEKIKRLPLILLgacvigFGVPVGIILFCYSQITLKLCRT---AKENPLTEKsghhKKACNVILLVLLVFVVC 225
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 149064702 246 FVPYHIARIPYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15159  226 FSPYHLNIIQFMIRKLLYQPSCSELKAFKISLQITVCLMNLNCCLDPFIYFFACKGYKK 284
7tmA_Angiotensin_R-like cd14985
angiotesin receptor family and its related G protein-coupled receptors, member of the class A ...
25-303 5.72e-29

angiotesin receptor family and its related G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the angiotensin receptors, the bradykinin receptors, apelin receptor as well as putative G-protein coupled receptors (GPR15 and GPR25). Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2 receptor, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Bradykinins (BK) are pro-inflammatory peptides that mediate various vascular and pain responses to tissue injury through its B1 and B2 receptors. Apelin (APJ) receptor binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body, and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake. Orphan receptors, GPR15 and GPR25, share strong sequence homology to the angiotensin II type AT1 and AT2 receptors.


Pssm-ID: 341320  Cd Length: 284  Bit Score: 112.47  E-value: 5.72e-29
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd14985    3 IPALYIAIFLVGLLGNLFVVWVFLFPRGPKRVAdIFIANLAAADLVFVLTLPLWATYTANQYDWPFGAFLCKVSSYVISV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTN-QSVKDVTNIQCMELKNElgRK 182
Cdd:cd14985   83 NMFASIFLLTCMSVDRYLAIVHPVASRRLRRRRQARVTCALIWVVACLLSLPTFLLRSlQAIENLNKTACIMLYPH--EA 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVF-YMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd14985  161 WHFGLSLELNILGFVLPLLIILTcYFHIARSLRKRYERTGKNGRK-RRKSLKIIFALVVAFLVCWLPFHFFKFLDFLAQL 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 262 EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd14985  240 GAIRPCFWELFLDLGLPIATCLAFTNSCLNPFIYVFVDRRFR 281
7tmA_P2Y1-like cd15168
P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of ...
25-303 1.89e-28

P2Y purinoceptors 1, 2, 4, 6, 11 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14). This cluster only includes P2Y1-like receptors as well as other closely related orphan receptors, such as GPR91 (a succinate receptor) and GPR80/GPR99 (an alpha-ketoglutarate receptor).


Pssm-ID: 341329 [Multi-domain]  Cd Length: 284  Bit Score: 111.26  E-value: 1.89e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSS-KSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15168    3 LPIVYGVVFLVGLLLNSVVLYRFIFHLKPwNSSAIYMFNLAVSDLLYLLSLPFLIYYYANGDHWIFGDFMCKLVRFLFYF 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDvTNIQCMEL-KNELGRK 182
Cdd:cd15168   83 NLYGSILFLTCISVHRYLGICHPLRSLGKLKKRHAVAISVAVWILVLLQLLPILFFATTGRKN-NRTTCYDTtSPEELND 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKShLKSRKNSiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15168  162 YVIYSMVLTGLGFLLPLLIILACYGLIVRALIRK-LGEGVTS-ALRRKSIRLVIIVLALFAVCFLPFHVTRTINLAARLL 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 263 GHYSCQAKETLLY-TKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15168  240 SGTASCATLNGIYvAYKVTRPLASLNSCLNPLLYFLAGDKFR 281
7tmA_P2Y4 cd15374
P2Y purinoceptor 4, member of the class A family of seven-transmembrane G protein-coupled ...
24-306 6.09e-28

P2Y purinoceptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y4 belongs to the P2Y receptor family of purinergic G-protein coupled receptors. This family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320496  Cd Length: 285  Bit Score: 109.89  E-value: 6.09e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15374    2 LLPVSYGLVFVVGLPLNATALWLFiKRMRPWNPTTVYMFHLALSDTLYVLSLPTLIYYYADHNHWPFGVVACKIVRFLFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15374   82 ANLYCSILFLTCISVHRYVGICHPIRALRWVKPRHAYLICASVWLVVTVCLVPNLIFVTTSRKDNITLCHDTTRPEEFDH 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISV-KRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15374  162 YVHYSSAVMVLLFGIPCLVIVVCYGLMARRLCKPRVGSSRQQGPSsKKRSLKTIIMVLTVFAICFVPFHITRTLYYVARL 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 149064702 262 EGhYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15374  242 LK-ADCDTLNIINVTYKVTRPLASANSCLDPILYFLAGDKYRRRL 285
7tmA_Opioid_R-like cd14970
opioid receptors and related proteins, member of the class A family of seven-transmembrane G ...
24-303 9.06e-28

opioid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes opioid receptors, somatostatin receptors, melanin-concentrating hormone receptors (MCHRs), and neuropeptides B/W receptors. Together they constitute the opioid receptor-like family, members of the class A G-protein coupled receptors. Opioid receptors are coupled to inhibitory G proteins of the G(i/o) family and are involved in regulating a variety of physiological functions such as pain, addiction, mood, stress, epileptic seizure, and obesity, among many others. G protein-coupled somatostatin receptors (SSTRs), which display strong sequence similarity with opioid receptors, binds somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. MCHR binds melanin concentrating hormone and is presumably involved in the neuronal regulation of food intake. Despite strong homology with somatostatin receptors, MCHR does not appear to bind somatostatin. Neuropeptides B/W receptors are primarily expressed in the CNS and stimulate the cortisol secretion by activating the adenylate cyclase- and the phospholipase C-dependent signaling pathways.


Pssm-ID: 320101 [Multi-domain]  Cd Length: 282  Bit Score: 109.31  E-value: 9.06e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFkVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd14970    2 VIPAVYSVVCVVGLTGNSLVIYVILRYSKMKTVTnIYILNLAVADELFLLGLPF-LATSYLLGYWPFGEVMCKIVLSVDA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPllvsiVQSVNY-----SKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKN 177
Cdd:cd14970   81 YNMFTSIFCLTVMSVDRYLAVVHP-----VKSLRFrtprkAKLVSLCVWALSLVLGLPVIIFARTLQEEGGTISCNLQWP 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 178 ELGRKWHKASN-YVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISV---KRKSSRNIFSIVLVFVVCFVPYHIAR 253
Cdd:cd14970  156 DPPDYWGRVFTiYTFVLGFAVPLLVITVCYSLIIRRLRSSRNLSTSGAREKrraRRKVTRLVLVVVAVFVVCWLPFHVFQ 235
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 149064702 254 IpytksqTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd14970  236 I------VRLLIDPPETLTVVGVFLFCIALSYANSCLNPILYAFLDENFR 279
7tmA_Chemokine_R cd14984
classical and atypical chemokine receptors, member of the class A family of ...
25-306 9.50e-28

classical and atypical chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. In addition to these classical chemokine receptors, there exists a subfamily of atypical chemokine receptors (ACKRs) that are unable to couple to G-proteins and, instead, they preferentially mediate beta-arrestin dependent processes, such as receptor internalization, after ligand binding. The classical chemokine receptors contain a conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. However, the ACKRs lack this conserved motif and fail to couple to G-proteins and induce classical GPCR signaling. Five receptors have been identified for the ACKR family, including CC-chemokine receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, Duffy antigen receptor for chemokine (DARC), and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 341319 [Multi-domain]  Cd Length: 278  Bit Score: 109.23  E-value: 9.50e-28
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVlsDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd14984    3 LPVLYSLVFLLGLVGNSLVLLVLLYYRKLRSMTdVYLLNLALADLLFVLTLPFWA--VYAADGWVFGSFLCKLVSALYTI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKW 183
Cdd:cd14984   81 NFYSGILFLACISIDRYLAIVHAVSALRARTLLHGKLTCLGVWALALLLSLPEFIFSQVSEENGSSICSYDYPEDTATTW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSI-FWIVFLLLTVFYMAITRKIFKSHLKSrknsisvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd14984  161 KTLLRLLQNILgFLLPLLVMLFCYSRIIRTLLRARNHK-------KHRALRVIFAVVVVFFLCWLPYNIVLLLDTLQLLG 233
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 149064702 263 G-HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd14984  234 IiSRSCELSKSLDYALQVTESLAFSHCCLNPVLYAFVGVKFRKYL 278
7tmA_CysLTR cd15921
cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G ...
23-306 1.33e-27

cysteinyl leukotriene receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Cysteinyl leukotrienes (LTC4, LTD4, and LTE4) are the most potent inflammatory lipid mediators that play an important role in human asthma. They are synthesized in the leucocytes (cells of immune system) from arachidonic acid by the actions of 5-lipoxygenase and induce bronchial constriction through G protein-coupled receptors, CysLTR1 and CysLTR2. Activation of CysLTR1 by LTD4 induces airway smooth muscle contraction and proliferation, eosinophil migration, and damage to the lung tissue. They belong to the class A GPCR superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320587 [Multi-domain]  Cd Length: 283  Bit Score: 109.13  E-value: 1.33e-27
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFFYV-PSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd15921    1 LFYPTAYILIFILGLTGNSISVYVFLSQyRSQTPVSVLMVNLAISDLLLVCTLPLRLTYYVLNSHWPFGDIACRIILYVL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQSVKDVTNIQCMELKNELGR 181
Cdd:cd15921   81 YVNMYSSIYFLTALSVFRYLALVWPYLYLRVQTHSVAGIICGLIWILMGLASSP-LLFAKSKQHDEGSTRCLELAHDAVD 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15921  160 KLLLINYVTLPVGFVVPFMTVIFCYIFIIKNLLKPSPALGRTRPS-RRKACALIIISLGIFLVCFLPYHIVRTIHLITER 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 149064702 262 EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15921  239 QIKESCGYILRVRKAAVITLCLAASNSCFDPLLYFFVGENFRSRL 283
7tm_1 pfam00001
7 transmembrane receptor (rhodopsin family); This family contains, amongst other ...
40-295 1.18e-26

7 transmembrane receptor (rhodopsin family); This family contains, amongst other G-protein-coupled receptors (GCPRs), members of the opsin family, which have been considered to be typical members of the rhodopsin superfamily. They share several motifs, mainly the seven transmembrane helices, GCPRs of the rhodopsin superfamily. All opsins bind a chromophore, such as 11-cis-retinal. The function of most opsins other than the photoisomerases is split into two steps: light absorption and G-protein activation. Photoisomerases, on the other hand, are not coupled to G-proteins - they are thought to generate and supply the chromophore that is used by visual opsins.


Pssm-ID: 333754 [Multi-domain]  Cd Length: 255  Bit Score: 105.85  E-value: 1.18e-26
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702   40 NGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGL-TFPFKVLSDSGlGPWQLNVFVCRVSAVIFYVNMYVSIAFFGLISF 117
Cdd:pfam00001   2 NLLVILVILRNKKLRTpTNIFLLNLAVADLLFLLlTLPFWLVYYLH-GTWPFGSALCKLVTFLDVVNGYASILLLTAISI 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  118 DRYYKIVKPLLVSivQSVNYSKVLSVLVWVLMLLLAVPNIILTNQ-SVKDVTNIQCMELKNElgRKWHKASN-YVFVSIF 195
Cdd:pfam00001  81 DRYLAIVHPLRYR--RIMRRAKAIILLIWVLALLLSLPPLLGWNTlDIPSNGVTSCLITFPE--SLWPVSYLlFSTVLGF 156
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  196 WIVFLLLTVFYMAITRKIFKsHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHYSCQAKETLLY 275
Cdd:pfam00001 157 LLPLLVILVCYTRIIRTLRK-QQSSSIRSVRSERKALKTLLVVVVVFILCWLPYHILLLLDSLCDLGIIISCEVVTPPRT 235
                         250       260
                  ....*....|....*....|
gi 149064702  276 TKEFTLLLSAANVCLDPIIY 295
Cdd:pfam00001 236 LLQLTVWLAYSNSCLNPIIY 255
7tmA_GPR15 cd15194
G protein-coupled receptor 15, member of the class A family of seven-transmembrane G ...
24-298 2.95e-25

G protein-coupled receptor 15, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR15, also called as Brother of Bonzo (BOB), is an orphan G-protein coupled receptor that was originally identified as a co-receptor for human immunodeficiency virus. GPR15 is upregulated in patients with rheumatoid arthritis and shares high sequence homology with angiotensin II type AT1 and AT2 receptors; however, its endogenous ligand is unknown. GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation.


Pssm-ID: 320322 [Multi-domain]  Cd Length: 281  Bit Score: 102.63  E-value: 2.95e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15194    2 FLPILYCLVFLVGAVGNAILMGALVFKRGVRRLIdIFISNLAASDFIFLVTLPLWVDKEVVLGPWRSGSFLCKGSSYIIS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQSVKDVTNIQCMELK-NELGR 181
Cdd:cd15194   82 VNMYCSVFLLTCMSLDRYLAIVLPLVSRKFRTKHNAKVCCTCVWMLSCLLGLP-TLLSRELKKYEEKEYCNEDAgTPSKV 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWhkaSNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVkRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15194  161 IF---SLVSLIVAFFLPLLSILTCYCTIIWKLCHHYQKSGKHQKKL-RKSIKIVFIVVAAFVFSWMPFNLFKALAIASGL 236
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 149064702 262 EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFL 298
Cdd:cd15194  237 QVEVTCLPYTLAQLGMEVSAPLAFANSCANPFIYYFF 273
7tm_classA_rhodopsin-like cd00637
rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor ...
28-298 3.44e-25

rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Class A rhodopsin-like receptors constitute about 90% of all GPCRs. The class A GPCRs include the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes. Based on sequence similarity, GPCRs can be divided into six major classes: class A (rhodopsin-like family), class B (Methuselah-like, adhesion and secretin-like receptor family), class C (metabotropic glutamate receptor family), class D (fungal mating pheromone receptors), class E (cAMP receptor family), and class F (frizzled/smoothened receptor family). Nearly 800 human GPCR genes have been identified and are involved essentially in all major physiological processes. Approximately 40% of clinically marketed drugs mediate their effects through modulation of GPCR function for the treatment of a variety of human diseases including bacterial infections.


Pssm-ID: 341313 [Multi-domain]  Cd Length: 275  Bit Score: 102.36  E-value: 3.44e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMY 106
Cdd:cd00637    4 LYILIFVVGVVGNLLVILVILRNRRLRTVTnYFILNLAVADLLVGLLVIPFSLVSLLLGGWWFGDALCKLLGFLQTVSLT 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 107 VSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRKWHka 186
Cdd:cd00637   84 ASILTLTAISVDRYLAIVHPLRYRRRFTRRRAKLVIALIWLLSLLLALPPLLGWKVYDYGGYCCCCLCWPDSTLRKAY-- 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 187 SNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLK--------SRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTK 258
Cdd:cd00637  162 TIFLFVLLFLLPLLVIIVCYVRIFRKLRRHRRRirrsssnsSRRRRRRRERKVTKMLLIVVVVFLLCWLPYFILLLLDVF 241
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|
gi 149064702 259 SQTEGHYSCqaketllYTKEFTLLLSAANVCLDPIIYFFL 298
Cdd:cd00637  242 GPDPSPLPR-------ILYFLALLLAYLNSAINPIIYAFF 274
PHA03087 PHA03087
G protein-coupled chemokine receptor-like protein; Provisional
24-315 4.87e-25

G protein-coupled chemokine receptor-like protein; Provisional


Pssm-ID: 222976 [Multi-domain]  Cd Length: 335  Bit Score: 102.93  E-value: 4.87e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKvLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:PHA03087  42 ILIVVYSTIFFFGLVGNIIVIYVLTKTKIKTPMDIYLLNLAVSDLLFVMTLPFQ-IYYYILFQWSFGEFACKIVSGLYYI 120
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELkNELGRKW 183
Cdd:PHA03087 121 GFYNSMNFITVMSVDRYIAIVHPVKSNKINTVKYGYIVSLVIWIISIIETTPILFVYTTKKDHETLICCMFY-NNKTMNW 199
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSI-FWIVFLLLTVFYMAITRKIFKSHLKSRknsisvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:PHA03087 200 KLFINFEINIIgMLIPLTILLYCYSKILITLKGINKSKK------NKKAIKLVLIIVILFVIFWLPFNVSVFVYSLHILH 273
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|...
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVLNKKLRMSLT 315
Cdd:PHA03087 274 FKSGCKAVKYIQYALHVTEIISLSHCCINPLIYAFVSEFFNKHKKKSLKLMFT 326
7tmA_P2Y6_P2Y3-like cd15968
P2Y purinoceptors 6 and 3, and similar proteins, member of the class A family of ...
24-303 9.17e-25

P2Y purinoceptors 6 and 3, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes P2Y receptor 6 (P2Y6), P2Y3, and P2Y3-like proteins. These receptors belong to the G(i) class of a family of purinergic G-protein coupled receptors. In the CNS, P2Y6 plays a role in microglia activation and phagocytosis, and is involved in the secretion of interleukin from monocytes and macrophages in the immune system. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320634  Cd Length: 285  Bit Score: 101.39  E-value: 9.17e-25
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSS-KSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15968    2 LLPICYSFVFLLGLPLNSVVLTRCCRHTKAwTRTAIYMVNLALADLLYALSLPLLIYNYAMRDRWLFGDFMCRLVRFLFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKdVTNIQCMELK-NELGR 181
Cdd:cd15968   82 FNLYGSILFLTCISVHRYLGICHPMRPWHKETRRAAWLTCVLVWILVFAQTLPILIFARTGII-RNRTVCYDLApPALFP 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15968  161 HYVPYGMALTVSGFLLPFSIILWCYCLVVRTLCRTLGPAEPPAQARRRKSIRTIVTVTLLFALCFLPFHITRTIYLAVRV 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 262 EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15968  241 TPGVPCHVLEAVAACYKITRPLASANSVLNPLLYFLTKKKFG 282
7tmA_PAR cd15162
protease-activated receptors, member of the class A family of seven-transmembrane G ...
25-304 2.25e-24

protease-activated receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily includes purinergic receptor P2Y8 and protease-activated receptors. P2Y8 (or P2RY8) expression is often increased in leukemia patients, and it plays a role in the pathogenesis of acute leukemia. P2Y8 is phylogenetically closely related to the protease-activated receptors (PARs), which are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. Four different types of the protease-activated receptors have been identified (PAR1-4) and are predominantly expressed in platelets. PAR1, PAR3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 341328  Cd Length: 280  Bit Score: 100.21  E-value: 2.25e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFY-VPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15162    3 LPAVYTLVFVVGLPANGMALWVLLFrTKKKAPAVIYMANLAIADLLLVIWLPFKIAYHIHGNNWIFGEALCRLVTVAFYG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQS--VKDVTNIQCMELKNE--L 179
Cdd:cd15162   83 NMYCSILLLTCISIDRYLAIVHPMGHRRLRARRYALGTCLAIWLLALLVTLP-LYLVKQTifLPALDITTCHDVLPEqlL 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 180 GRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKifkshLKSRKNSISVKRKsSRNIFSIVLV---FVVCFVPYHIARIPY 256
Cdd:cd15162  162 VGDWFYYFLSLAIVGFLIPFILTASCYVATIRT-----LAALEDENSEKKK-KRAIKLAATVlaiFIICFAPSNLLLLAH 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 149064702 257 TKSqteghYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15162  236 YSL-----ISSSGTGHLYFAYLLALCLSTLNSCIDPFIYYFVSKEFRD 278
7tmA_P2Y2 cd15373
P2Y purinoceptor 2, member of the class A family of seven-transmembrane G protein-coupled ...
24-303 2.40e-24

P2Y purinoceptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y2 belongs to the P2Y receptor family of purinergic G-protein coupled receptors and is implicated to play a role in the control of the cell cycle of endometrial carcinoma cells. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320495  Cd Length: 283  Bit Score: 100.21  E-value: 2.40e-24
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFY-VPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15373    2 LLPVSYGIVFVVGLVLNILALYVFLFrTKPWNASTTYMFNLAISDTLYVLSLPLLVYYYADENDWPFSEALCKIVRFLFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDvTNIQCMELKN-ELGR 181
Cdd:cd15373   82 TNLYCSILFLLCISVHRFLGVCYPVRSLRWLKVRYARIVSVVVWVIVLACQSPVLYFVTTSDKG-GNITCHDTSSpELFD 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQT 261
Cdd:cd15373  161 QFVVYSSVMLVLLFCVPFVVILVCYALMVRKLLKPSAGTSTNSRS-KKKSVKMIIIVLAVFILCFLPFHVTRTLYYSFRS 239
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|..
gi 149064702 262 EgHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15373  240 M-DLSCGTLNAINLAYKVTRPLASANSCLDPILYFLAGQSFR 280
7tmA_GPR82 cd14996
orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G ...
25-306 1.18e-23

orphan G protein-coupled receptor 82, member of the class A family of seven-transmembrane G protein-coupled receptors; This subgroup represents the G-protein coupled receptor 82 of unknown function. GPR82 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320127  Cd Length: 305  Bit Score: 98.72  E-value: 1.18e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFF-YVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVS----AV 99
Cdd:cd14996    3 LPIIYSFLFVTGVFGNLLSLWVFLtKISKKTSTHIYLINLVTANLLVCSAMPFQAAYFLKGFYWKYQSTQCRIAnffgTL 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 100 IFYVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSV----------------NYSKVLSVLVWVLMLLLAVPNIILTNQS 163
Cdd:cd14996   83 VIHVSMCVSILILSWIAISRYATLMKHDSATQKQSCyekifyghflkrfrqpKFARYLCIYIWGVVLCIIIPVVVYYSVR 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 164 VKDV-TNIQCMELKNELGRKWHKASNYVFVSIFWIVFLLLTVFYMAitrkiFKSHL-KSRKN-SISVK----RKSSRNIF 236
Cdd:cd14996  163 EADEdGESLCYNRQVELGAKGSQIAGLIATTFFFLFFLVVLLSYYS-----FVNHLrRIQKNtCISEKdliyRSVKRNIL 237
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
gi 149064702 237 SIVLVFVVCFVPYHIAR-IPYTKSQTEGhysCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd14996  238 IIQALLVVCFLPYHIFKpVFYVLHQRED---CQQLNYLIETKNILTCLASARSSTDPIMYLLLDKTFKKTL 305
7tmA_Proton-sensing_R cd15160
proton-sensing G protein-coupled receptors, member of the class A family of ...
26-303 1.81e-23

proton-sensing G protein-coupled receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; Proton/pH-sensing G-protein coupled receptors sense pH of 7.6 to 6.0. They mediate a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. The proton/pH-sensing receptor family includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 (TDAG8, GPR65) receptor, ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4).


Pssm-ID: 320288 [Multi-domain]  Cd Length: 280  Bit Score: 97.46  E-value: 1.81e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  26 PMLYCVVFITGVLLNGISGW-IFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVN 104
Cdd:cd15160    4 PVVYSFVFVVGLPANCLALWvLYLQIKKENVLGVYLLNLSLSDLLYILTLPLWIDYTANHHNWTFGPLSCKVVGFFFYTN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 105 MYVSIAFFGLISFDRYYKIVKPLLVSIVQSVnysKVLSVLVWVLMLLLAVPNIIL--TNQSVKDVTNIQ-CMElKNELGr 181
Cdd:cd15160   84 IYASIGFLCCIAVDRYLAVVHPLRFRGLRTR---RFALKVSASIWVLELGTHSVFlgHDELFRDEPNHTlCYE-KYPME- 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNY--VFVSiFWIVFLLLTVFYMAITRKIFKSHLKSRKNsisvKRKSSRNIFSIVLVFVVCFVPYHIarIPYTKS 259
Cdd:cd15160  159 GWQASYNYarFLVG-FLIPLSLILFFYRRVLRAVRQSPSLEREE----KRKIIGLLLSIVVIFLLCFLPYHV--VLLVRS 231
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 260 QTEGHYS--CQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15160  232 VIELVQNglCGFEKRVFTAYQISLCLTSLNCVADPILYIFVTEDVR 277
7tmA_LPAR5 cd15154
lysophosphatidic acid receptor 5, member of the class A family of seven-transmembrane G ...
29-306 2.31e-23

lysophosphatidic acid receptor 5, member of the class A family of seven-transmembrane G protein-coupled receptors; Lysophosphatidic acid receptor 5 (LPAR5) is a G protein-coupled receptor that binds the bioactive lipid lysophosphatidic acid (LPA) and is involved in maintenance of human hair growth. Phylogenetic analysis of the class A GPCRs shows that LAPR5 is classified into the cluster consisting receptors that are preferentially activated by adenosine and uridine nucleotides. Although LPA6 (P2Y5) is expressed in human hair follicle cells, LPA4 and LPA5 are not. These three receptors are highly homologous and mediate an increase in intracellular cAMP production. Activation of LPAR5 is coupled to G(q) and G(12/13) proteins.


Pssm-ID: 320282  Cd Length: 285  Bit Score: 97.53  E-value: 2.31e-23
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  29 YCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKvLSDSGLGPWQLNVFVCRVSAVIFYVNMYV 107
Cdd:cd15154    7 YSLLFPVGLLLNAVALWVFVRYLRLHSVVsIYMCNLALSDLLFTLSLPLR-IYYYANHYWPFGNFLCQFSGSIFQMNMYG 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 108 SIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSvkdvtniQCMELKNELGRKWHKAS 187
Cdd:cd15154   86 SCLFLMCINVDRYLAIVHPLRFRHLRRPKVARLLCLAVWALILGGSVPAAIVHSSS-------DCLLHGEKVYRCFESFS 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 188 NYVFVSIFWIV-------FLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQ 260
Cdd:cd15154  159 DNDWKGLLPLVvlaeilgFLLPLAAVLYCSCRIFVELCRTQEPQQGRRRKTVRLLLVNLVIFLICFVPYNTTLAVYGLLR 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 149064702 261 TE-GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15154  239 ANlVEDTWNIKDTLRKVLSVTVLLASTNCALDPLVYYFSTEGFRNTL 285
7tmA_XCR1 cd15182
XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
24-303 2.23e-22

XC chemokine receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; XCR1 is a chemokine receptor specific for XCL1 and XCL2 (previously called lymphotatctin alpha/beta), which differ in only two amino acids. XCL1/2 is the only member of the C chemokine subfamily, which is unique as containing only two of the four cysteines that are found in other chemokine families. Human XCL1/2 has been shown to be secreted by activated CD8+ T cells and upon activation of the innate immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling.


Pssm-ID: 341337 [Multi-domain]  Cd Length: 271  Bit Score: 94.35  E-value: 2.23e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGlgPWQLNVFVCRVSAVIFY 102
Cdd:cd15182    2 FLPVFYYLVFLLSLLGNGLVLWILVKYEKLKTLTnIFILNLAISDLLFTFTLPFWASYHSS--GWIFGEILCKAVTSIFY 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCmelkNELGRK 182
Cdd:cd15182   80 IGFYSSILFLTLMTIDRYLAVVHPLSALRSRKLRYASLVSVAVWVISILASLPELILSTVMKSDEDGSLC----EYSSIK 155
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKsrknsisVKRKSSRNIFSIVLVFVVCFVPYHIArIPYTKSQTE 262
Cdd:cd15182  156 WKLGYYYQQNLFFLIPLGIIVYCYVRILQTLMRTRTM-------RKHRTVKLIFVIVLVFFLSWAPYNIV-IFLRSLKDL 227
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15182  228 TIPICECSKQLDYAFYICRNIAFSHCCLNPVFYVFVGVKFR 268
7tmA_P2Y-like cd15922
P2Y purinoceptor-like proteins, member of the class A family of seven-transmembrane G ...
25-305 3.42e-22

P2Y purinoceptor-like proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y-like proteins are an uncharacterized group that is phylogenetically related to a family of purinergic G protein-coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5 and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12 and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320588  Cd Length: 284  Bit Score: 94.01  E-value: 3.42e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15922    3 IPVFLSLVFLGGFLLNSFSLWIFwFRIKQWSSGTILQFNLALSDAIITPAAPLLIAYFSLGSHWPFGQFLCQLKVFLLST 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTnIQCMEL-KNELgrk 182
Cdd:cd15922   83 HMYGSIYFLMLISIHRYVTVVHYNWKSLWKKKSFMKKLCLGVWLLLFVQGLPFFFVLKTSVIDGK-TKCLSIhQSEL--- 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 whkASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSIS-----VKRKSSRNIFSIVLVFVVCFVPYHIARIPYT 257
Cdd:cd15922  159 ---SLLYFVWNFVLLILGFLLPFGVSLTCYALLGASIAKMNSNNargraMKAKSLQMIGISLVIFIICFVPLHVTRTVGV 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 149064702 258 KSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREV 305
Cdd:cd15922  236 VVKLFYPESCTLLHKVEVAYYISWVLTGVNCCLDPLLYCFASEKFRKS 283
7tmA_Apelin_R cd15190
apelin receptor, member of the class A family of seven-transmembrane G protein-coupled ...
24-303 7.48e-22

apelin receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Apelin (APJ) receptor is a G protein-coupled receptor that binds the endogenous peptide ligands, apelin and Toddler/Elabela. APJ is an adipocyte-derived hormone that is ubiquitously expressed throughout the human body and Toddler/Elabela is a short secretory peptide that is required for normal cardiac development in zebrafish. Activation of APJ receptor plays key roles in diverse physiological processes including vasoconstriction and vasodilation, cardiac muscle contractility, angiogenesis, and regulation of water balance and food intake.


Pssm-ID: 341340  Cd Length: 304  Bit Score: 93.67  E-value: 7.48e-22
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSK--SFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd15190   12 LIPVIYMLVFVLGLSGNGLVLWTVFRSKRKRrrSADTFIANLALADLTFVVTLPLWAVYTALGYHWPFGSFLCKLSSYLV 91
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTN-IQCMELKNELG 180
Cdd:cd15190   92 FVNMYASVFCLTGLSFDRYLAIVRSLASAKLRSRTSGIVALGVIWLLAALLALPALILRTTSDLEGTNkVICDMDYSGVV 171
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 181 RKWHKASNYVFVSI------FWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARI 254
Cdd:cd15190  172 SNESEWAWIAGLGLsstvlgFLLPFLIMLTCYFFIGRTVARHFSKLRRKEDKKKRRLLKIIITLVVTFALCWLPFHLVKT 251
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 149064702 255 PYTKSQTEG-HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15190  252 LYALMYLGIlPFSCGFDLFLMNAHPYATCLAYVNSCLNPFLYAFFDPRFR 301
7tmA_P2Y1 cd15377
P2Y purinoceptor 1, member of the class A family of seven-transmembrane G protein-coupled ...
25-306 1.31e-21

P2Y purinoceptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y1 belongs to the P2Y receptor family of purinergic G-protein coupled receptors. This family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 341350  Cd Length: 289  Bit Score: 92.67  E-value: 1.31e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15377    3 LPAVYILVFITGFLGNSVAIWMFvFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHV 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMEL-KNELGRK 182
Cdd:cd15377   83 NLYGSILFLTCISVHRYTGVVHPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGTGVRKNKTITCYDTtSDEYLRS 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFYMAITRK-IFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHI-------ARI 254
Cdd:cd15377  163 YFIYSMCTTVAMFCVPFILILGCYGLIVRAlIYKDMKYTEENNAPLRRKSIYLVIIVLTVFAVSYLPFHVmktlnlrARL 242
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|..
gi 149064702 255 PYTKSQTeghysCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15377  243 DFQTPAM-----CAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRL 289
7tmA_LPAR6_P2Y5 cd15156
lysophosphatidic acid receptor 6, member of the class A family of seven-transmembrane G ...
27-297 4.74e-21

lysophosphatidic acid receptor 6, member of the class A family of seven-transmembrane G protein-coupled receptors; Lysophosphatidic acid receptor 6 (LPAR6), also known as P2Y5, is a G(i), G(12/13) G protein-coupled receptor that is activated by the bioactive lipid lysophosphatidic acid (LPA), which is released by activated platelets and constitutively present in serum. LPAR6 plays an important role in maintenance of human hair growth. Thus, mutations in the receptor are responsible for both autosomal recessive wooly hair and hypotrichosis. Phylogenetic analysis of the class A GPCRs shows that LAPR6 (P2Y5) is classified into the cluster consisting of receptors that are preferentially activated by adenosine and uridine nucleotides. Although LPA6 (P2Y5) is expressed in human hair follicle cells, LPA4 and LPA5 are not. These three receptors are highly homologous and mediate an increase in intracellular cAMP production.


Pssm-ID: 320284  Cd Length: 285  Bit Score: 91.07  E-value: 4.74e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  27 MLYCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKVLSDSGLGpWQLNVFVCRVSAVIFYVNM 105
Cdd:cd15156    5 CVFSMVFVLGLIANCVAIYIFMCTLKVRNeTTTYMINLAISDLLFVFTLPFRIFYFVQRN-WPFGDLLCKISVTLFYTNM 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 106 YVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTN-IQCMELKNELGRKWH 184
Cdd:cd15156   84 YGSILFLTCISVDRFLAIVYPFRSKTLRTKRNAKIVCAAVWLTVLAGSLPASFFQSTNNQLNNNsETCFENFSSKTWKTY 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 185 KASNYVFVSIF-WIVFLLLTVFYMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEG 263
Cdd:cd15156  164 LSKIVIFIEIVgFFIPLILNVTCSTMVLKTLRRPNTLSRSKLN-KKKVLKMIFVHLFIFCFCFIPYNVNLVLYSLVRTQT 242
                        250       260       270
                 ....*....|....*....|....*....|....
gi 149064702 264 HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFF 297
Cdd:cd15156  243 FKNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYF 276
7tmA_HCAR-like cd14991
hydroxycarboxylic acid receptors and related proteins, member of the class A family of ...
23-306 7.04e-21

hydroxycarboxylic acid receptors and related proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This group includes the hydroxycarboxylic acid receptors (HCARs) as well as their closely related receptors, GPR31 and oxoeicosanoid receptor 1 (OXER1). HCARs are members of the class A family of G-protein coupled receptors (GPCRs). HCAR subfamily contain three receptor subtypes: HCAR1, HCAR2, and HCAR3. The endogenous ligand of HCAR1 (also known as lactate receptor 1, GPR104, or GPR81) is L-lactic acid. The endogenous ligands of HCAR2 (also known as niacin receptor 1, GPR109A, nicotinic acid receptor) and HCAR3 (also known as niacin receptor 2, orGPR109B) are 3-hydroxybutyric acid and 3-hydroxyoctanoic acid, respectively. All three HCA receptors are expressed in adipocytes, and are coupled to G(i)-proteins mediating anti-lipolytic effects in fat cells. OXER1 is a receptor for eicosanoids and polyunsaturated fatty acids such as 5-oxo-6E,8Z,11Z,14Z-eicosatetraenoic acid (5-OXO-ETE), 5(S)-hydroperoxy-6E,8Z,11Z,14Z-eicosatetraenoic acid (5(S)-HPETE) and arachidonic acid, whereas GPR31 is a high-affinity receptor for 12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid (12-S-HETE).


Pssm-ID: 320122  Cd Length: 280  Bit Score: 90.58  E-value: 7.04e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd14991    1 SILPPLLILEFVLGLPGNVVALWIFcFHSRTWKANTVYLFNLVLADFLLLICLPFRIDYYLRGEHWIFGEAWCRVNLFML 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQSVKDVTNIQC----MELKN 177
Cdd:cd14991   81 SVNRSASIAFLTAVALDRYFKVVHPHHRVNRMSVKAAAGVAGLLWALVLLLTLP-LLLSTLLTVNSNKSSChsfsSYTKP 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 178 ELGRKWHKAsnyVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSIsvkRKSSRNIFSIVLVFVVCFVPYHIARIPYT 257
Cdd:cd14991  160 SLSIRWHNA---LFLLEFFLPLGLIVFCSVRIACNLRIRQSLGKQARV---QRAIRLVFLVVIVFVLCFLPSIIAGLLAL 233
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*....
gi 149064702 258 KSQTEGhySCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd14991  234 VFKNLG--SCRCLNSVAQLFHISLAFTYLNSALDPVIYCFSSPWFRNSL 280
7tmA_Anaphylatoxin_R-like cd14974
anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class ...
24-304 9.53e-21

anaphylatoxin receptors and related G protein-coupled chemokine receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily of G-protein coupled receptors includes anaphylatoxin receptors, formyl peptide receptors (FPR), prostaglandin D2 receptor 2, GPR1, and related chemokine receptors. The anaphylatoxin receptors are a group of G-protein coupled receptors that bind anaphylatoxins. The members of this group include C3a and C5a receptors. The formyl peptide receptors (FPRs) are chemoattractant GPCRs that involved in mediating immune responses to infection. They are expressed mainly on polymorphonuclear and mononuclear phagocytes and bind N-formyl-methionyl peptides (FMLP), which are derived from the mitochondrial proteins of ruptured host cells or invading pathogens. Chemokine receptor-like 1 (also known as chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. Prostaglandin D2 receptor, also known as CRTH2, is a chemoattractant G-protein coupled receptor expressed on T helper type 2 cells that binds prostaglandin D2 (PGD2). PGD2 functions as a mast cell-derived mediator to trigger asthmatic responses and also causes vasodilation. PGD2 exerts its inflammatory effects by binding to two G-protein coupled receptors, the D-type prostanoid receptor (DP) and PD2R2 (CRTH2). PD2R2 couples to the G protein G(i/o) type which leads to a reduction in intracellular cAMP levels and an increase in intracellular calcium. GPR1 is an orphan receptor that can be activated by the leukocyte chemattractant chemerin, thereby suggesting that some of the anti-inflammatory actions of chemerin may be mediated through GPR1.


Pssm-ID: 320105 [Multi-domain]  Cd Length: 274  Bit Score: 90.05  E-value: 9.53e-21
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPM-LYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLkNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIF 101
Cdd:cd14974    1 IVSLvLYALIFLLGLPGNGLVIWVAgFKMKRTVNTVWFL-NLALADFLFCLFLPFLIVYIAMGHHWPFGSVLCKLNSFVI 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNEL-G 180
Cdd:cd14974   80 SLNMFASVFLLTAISLDRCLLVLHPVWAQNHRTVRLASVVCVGIWILALVLSVPYFVFRDTVTHHNGRSCNLTCVEDYdL 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 181 RKWHKASNYV--FVSIFWIVFLLLTVFYMAITRKIfkshlksRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIpytk 258
Cdd:cd14974  160 RRSRHKALTVirFLCGFLLPLLIIAICYSVIAVKL-------RRKRLAKSSKPLRVLLAVVVAFFLCWLPYHVFAL---- 228
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 259 sqTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd14974  229 --LELVAAAGLPEVVLLGLPLATGLAYFNSCLNPILYVFMGQDFRK 272
7tmA_GPR35_55-like cd15923
G protein-coupled receptor 35, GPR55, and similar proteins, member of the class A family of ...
29-304 4.86e-20

G protein-coupled receptor 35, GPR55, and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; This subfamily is composed of GPR35, GPR55, and similar proteins. GPR35 shares closest homology with GPR55, and they belong to the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A number of studies have suggested that GPR35 may play important physiological roles in hypertension, atherosclerosis, nociception, asthma, glucose homeostasis and diabetes, and inflammatory bowel disease. GPR35 is thought to be responsible for brachydactyly mental retardation syndrome, which is associated with a deletion comprising chromosome 2q37 in human, and is also implicated as a potential oncogene in stomach cancer. GPR35 couples to G(13) and G(i/o) proteins, whereas GPR55 has been reported to couple to G(13), G(12), or G(q) proteins. Activation of GPR55 leads to activation of phospholipase C, RhoA, ROCK, ERK, p38MAPK, and calcium release. Recently, lysophophatidylinositol (LPI) has been identified as an endogenous ligand for GPR55, while several endogenous ligands for GPR35 have been identified including kynurenic acid, 2-oleoyl lysophosphatidic acid, and zaprinast.


Pssm-ID: 320589 [Multi-domain]  Cd Length: 273  Bit Score: 87.90  E-value: 4.86e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  29 YCVVFITGVLLNGISGWIFFYVPSSKSF-IIYLKNIVVADFLMGLTFPFKVLSDSGlgPWQLNVFVCRVSAVIFYVNMYV 107
Cdd:cd15923    7 YIPTFVLGLLLNILALWVFCWRLKKWTEtNIYMTNLAVADLLLLISLPFKMHSYRR--ESAGLQKLCNFVLSLYYINMYV 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 108 SIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQsvkdVTNIQCMElknelgRKWHKAS 187
Cdd:cd15923   85 SIFTITAISVDRYVAIRYPLRARELRSPRKAAVVCAVIWVLVVTISIPYFLLDSS----NEKTMCFQ------RTKQTES 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 188 NYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKN--SISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEghY 265
Cdd:cd15923  155 LKVFLLLEIFGFLLPLIIMTFCSARVIHTLQKRLDDvgSRSETKQCIRVIMANLIVFIVCFLPVHVGFFVKFIVGKS--Y 232
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 149064702 266 SCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15923  233 SCDSKLIIHFFLQSAFCLSDMNCCLDAFCYYFATKEFRE 271
7tmA_P2Y8 cd15368
purinergic receptor P2Y8, member of the class A family of seven-transmembrane G ...
24-306 1.37e-19

purinergic receptor P2Y8, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y8 (or P2RY8) expression is often increased in leukemia patients, and it plays a role in the pathogenesis of acute leukemia. P2Y8 is phylogenetically closely related to the protease-activated receptors (PARs), which are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. Four different types of the protease-activated receptors have been identified (PAR1-4) and are predominantly expressed in platelets. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320490  Cd Length: 281  Bit Score: 86.75  E-value: 1.37e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15368    2 ILPVVYSLVALISIPGNLFSLWLLCFHTKPKTpSIIFMINLSLTDLMLACFLPFQIVYHIQRNHWIFGKPLCNVVTVLFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQS--VKDVTNIQCME-LKNEL 179
Cdd:cd15368   82 ANMYSSILTMTCISIERYLGVVYPMRSMRWRKKRYAVAACIGMWLLVLTALSP-LERTDLTyyVKELNITTCFDvLKWTM 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 180 ---GRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKShlkSRKNSISVKRKSSRNIFSIVLVFVVCFVP-------Y 249
Cdd:cd15368  161 lpnIAAWAAFLFTLFILLFLIPFIITVYCYVLIILKLVQT---SERYGREQKRRAIYLALIVLLVFITCFAPnnfillaH 237
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*..
gi 149064702 250 HIARIPYTKSqteghyscqaketLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15368  238 MVSRLFYGKS-------------LYHAYKLTLSLSCLNSCLDPFIYYFASKEFRKKL 281
7tmA_GPR55-like cd15165
G protein-coupled receptor 55 and similar proteins, member of the class A family of ...
29-305 1.58e-19

G protein-coupled receptor 55 and similar proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR55 shares closest homology with GPR35, and they belong to the class A G protein-coupled receptor superfamily, which all have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. GPR55 has been reported to couple to G(13), G(12), or G(q) proteins. Activation of GPR55 leads to activation of phospholipase C, RhoA, ROCK, ERK, p38MAPK, and calcium release. Lysophophatidylinositol (LPI) is currently considered as the endogenous ligand for GPR55, although the receptor was initially deorphanized as a cannabinoid receptor and binds many cannabinoid ligands.


Pssm-ID: 320293  Cd Length: 277  Bit Score: 86.62  E-value: 1.58e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  29 YCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGlgPWQLNVFVCRVSAVIFYVNMYV 107
Cdd:cd15165    7 YIPTFVLGLLLNLMALWVFlFKIKKWTESTIYMINLALNDLLLLLSLPFKMHSSKK--QWPLGRTLCSFLESLYFVNMYG 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 108 SIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNqsvKDVTNIQCmelknelgrkWHKAS 187
Cdd:cd15165   85 SILIIVCISVDRYIAIRHPFLAKRLRSPRKAAIVCLTIWVFVWAGSIPIYSFHD---KPTNNTRC----------FHGFS 151
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 188 NYVFvSIFWIVFLLLTVFYMAITRKIFKS-----HLKSRKNSISVKRKSSRNIFSIV---LVFVVCFVPYHIARIPYTKS 259
Cdd:cd15165  152 NKTW-SKKVIVVVEEFGFLIPMAVMVFCSvqiirTLLDMRRPEQPKVKQNKSVKIVLsnlVVFLVCFTPYHLGIFLQFLV 230
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 260 QTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREV 305
Cdd:cd15165  231 KNDIINDCSTKQSIRLFVQVSMCLANVNCCLDAICYYFILKEFRES 276
7tmA_P2Y10 cd15153
P2Y purinoceptor 10, member of the class A family of seven-transmembrane G protein-coupled ...
29-306 2.04e-19

P2Y purinoceptor 10, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y10 receptor is a G-protein coupled receptor that is activated by both sphingosine-1-phosphate (S1P) and lysophosphatidic acid (LPA). Phylogenetic analysis of the class A GPCRs shows that P2Y10 is grouped into the cluster comprising nucleotide and lipid receptors. Although the mouse P2Y10 was found to be expressed in brain, lung, reproductive organs, and skeletal muscle, the physiological function of this receptor is not yet known. S1P and LPA are bioactive lipid molecules that induce a variety of cellular responses through G proteins: adhesion, invasion, cell migration and proliferation, among many others.


Pssm-ID: 320281  Cd Length: 283  Bit Score: 86.39  E-value: 2.04e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  29 YCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKV---LSDSglgpWQLNVFVCRVSAVIFYVN 104
Cdd:cd15153    7 YIIIFIPGLLANSAALWVLCRFISKKNkAIIFMINLAVADLAHVLSLPLRIhyyIQHT----WPFGRFLCLLCFYLKYLN 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 105 MYVSIAFFGLISFDRYYKIVKPLLVSIVQSvNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDvTNIQCMElknELGRKWH 184
Cdd:cd15153   83 MYASICFLTCISIQRCFFLLHPFKARDWKR-RYDVGISAAVWIVVGLACLPFPLLRSKSLSN-NNRSCFA---DLGMKKL 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 185 KASNYV-FVSIFWIVFLLLTVFYMAITRKIFKSHLKSRK---NSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQ 260
Cdd:cd15153  158 NFGAAIaMMTVAELFGFVIPLFIIAWCTWKTENSLRQRNkqqQSTSEKQKALRMVRMCAAVFFICFAPYHINFLFYLMVS 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 261 TEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15153  238 ESIITNCEVSQVILQFHPISLCLASLNCCLDPILYYFMTSEFQDQL 283
7tmA_CMKLR1 cd15116
chemokine-like receptor 1, member of the class A family of seven-transmembrane G ...
28-304 2.36e-19

chemokine-like receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Chemokine receptor-like 1 (also known as Chemerin receptor 23) is a GPCR for the chemoattractant adipokine chemerin, also known as retinoic acid receptor responder protein 2 (RARRES2), and for the omega-3 fatty acid derived molecule resolvin E1. Interaction with chemerin induces activation of the MAPK and PI3K signaling pathways leading to downstream functional effects, such as a decrease in immune responses, stimulation of adipogenesis, and angiogenesis. On the other hand, resolvin E1 negatively regulates the cytokine production in macrophages by reducing the activation of MAPK1/3 and NF-kB pathways. CMKLR1 is prominently expressed in dendritic cells and macrophages.


Pssm-ID: 320244 [Multi-domain]  Cd Length: 284  Bit Score: 86.36  E-value: 2.36e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVNMYV 107
Cdd:cd15116    6 IYSVVFVLGVLGNGLVIFITGFKMKKTVNTVWFLNLAVADFLFTFFLPFSIAYTAMDFHWPFGRFMCKLNSFLLFLNMFT 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 108 SIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNII-------LTNQSVKDVTNIQCMELKNELG 180
Cdd:cd15116   86 SVFLLTVISIDRCISVVFPVWSQNHRSVRLASLVSLAVWVVAFFLSSPSFIfrdtapsQNNNKIICFNNFSLSGDNSSPE 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 181 RKWHKASNYVFVSI------FWIVFLLLTVFYMAITrkifkshLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARI 254
Cdd:cd15116  166 VNQLRNMRHQVMTItrfllgFLIPFTIIICCYAAIV-------LKLKRNRLAKSSKPFKIIAAVIVTFFLCWAPYHILNL 238
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 149064702 255 pytksqTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15116  239 ------LEMEATRSPASVFKIGLPITSSLAFINSCLNPILYVFMGQDFKK 282
7tmA_CCR8 cd15187
CC chemokine receptor type 8, member of the class A family of seven-transmembrane G ...
25-306 3.58e-19

CC chemokine receptor type 8, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR8, the receptor for the CC chemokines CCL1 and CC16, is highly expressed on allergen-specific T-helper type 2 cells, and is implicated in the pathogenesis of human asthma. CCL1- and CCR8-expressing CD4+ effector T lymphocytes are shown to have a critical role in lung mucosal inflammatory responses. CCR8 is also a functional receptor for CCL16, a liver-expressed CC chemokine that involved in attracting lymphocytes, dendritic cells, and monocytes. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 320315  Cd Length: 276  Bit Score: 85.62  E-value: 3.58e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFkvLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15187    3 LPVLYCLLFVFGLLGNSLVIWVLVACKKLRSMTdVYLLNLAASDLLFVFSLPF--QAYYLLDQWVFGNAMCKIVSGAYYI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILtNQSVKDVTNIQCMELKNELGRKW 183
Cdd:cd15187   81 GFYSSMFFITLMSIDRYLAIVHAVYALKVRTASHGTILSLALWLVAILASVPLLVF-YQVASEDGRLQCIPFYPGQGNSW 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYVFVSIFWIV-FLLLTVFYMAITRKIFKSHLKSRKNSIsvkrkssRNIFSIVLVFVVCFVPYHIARIPYTKSQTE 262
Cdd:cd15187  160 KVFTNFEVNILGLLIpFSILIFCYHNILRNLRRCHNQNKTKAI-------KLVFIVVIVFFLFWTPFNVVLFLDSLHSLH 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 263 GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15187  233 IIDGCQNSQRLTLALHLTETISFTHCCLNPVIYAFVGEKFKKHL 276
7tmA_PAR1 cd15369
protease-activated receptor 1, member of the class A family of seven-transmembrane G ...
24-297 1.91e-18

protease-activated receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320491  Cd Length: 281  Bit Score: 83.66  E-value: 1.91e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15369    2 FVPSVYTIVFVISLPLNILALVVFlRKMRVKKPAVIYMLNLACADLLFVLLLPFKIAYHFSGNDWLFGEAMCRVVTAAFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQS--VKDVTNIQCMELKNELG 180
Cdd:cd15369   82 CNMYCSILLMTCISVDRFLAVVYPMQSLSWRTLRRASFTCAAIWLLSIAGVVP-LLLSEQTiqIPDLGITTCHDVLNEQL 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 181 RKWHKASNY-VFVSIFWIV-FLLLTVFYMAITRKIfkshlkSRKNSISVKRKSSRNIF---SIVLVFVVCFVP------Y 249
Cdd:cd15369  161 LMGYYVYYFsIFSCLFFFVpLIITTVCYVSIIRCL------SSSSDVANSSKKTRALFmavAVFCVFVICFGPtnvlllA 234
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*...
gi 149064702 250 HIARIPYTKSqTEGHYSCQAketllytkeFTLLLSAANVCLDPIIYFF 297
Cdd:cd15369  235 HYVRFAYTST-NDASYFAYL---------LCVCVGSISCCLDPLIYYY 272
7tmA_SSTR1 cd15970
somatostatin receptor type 1, member of the class A family of seven-transmembrane G ...
24-303 2.41e-18

somatostatin receptor type 1, member of the class A family of seven-transmembrane G protein-coupled receptors; G protein-coupled somatostatin receptors (SSTRs) are composed of five distinct subtypes (SSTR1-5) that display strong sequence similarity with opioid receptors. All five receptor subtypes bind the natural somatostatin (somatotropin release inhibiting factor), a polypeptide hormone that regulates a wide variety of physiological functions such as neurotransmission, cell proliferation, contractility of smooth muscle cells, and endocrine signaling as well as inhibition of the release of many secondary hormones. SSTR1 is coupled to a Na/H exchanger, voltage-dependent calcium channels, and AMPA/kainate glutamate channels. SSTR1 is expressed in the normal human pituitary and in nearly half of all pituitary adenoma subtypes.


Pssm-ID: 320636 [Multi-domain]  Cd Length: 276  Bit Score: 83.42  E-value: 2.41e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFF-YVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSdSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15970    2 LISFIYSVVCLVGLCGNSMVIYVILrYAKMKTATNIYILNLAIADELLMLSVPFLVTS-TLLRHWPFGSLLCRLVLSVDA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15970   81 INMFTSIYCLTVLSIDRYIAVVHPIKAARYRRPTVAKMVNLGVWVFSILVILPIIIFSNTAPNSDGSVACNMQMPEPSQR 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKA-SNYVFVSIFWIVFLLLTVFYMAITRKI----FKSHLKSRKNSisvKRKSSRNIFSIVLVFVVCFVPYHIAripyt 257
Cdd:cd15970  161 WLAVfVVYTFLMGFLLPVIAICLCYILIIVKMrvvaLKAGWQQRKRS---ERKITLMVMMVVTVFVICWMPFYVV----- 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 258 ksQTEGHYSCQAKETLlytKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15970  233 --QLVSVFVGQHDATV---SQLSVILGYANSCANPILYGFLSDNFK 273
7tmA_PAR4 cd15372
protease-activated receptor 4, member of the class A family of seven-transmembrane G ...
24-304 3.96e-18

protease-activated receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 320494  Cd Length: 274  Bit Score: 82.49  E-value: 3.96e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15372    2 LVPSLYTLVFLVGLPANGLALWVLATQVKRLPSTIFLINLAVADLLLILVLPFKISYHFLGNNWPFGEGLCRVVTAFFYG 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPnIILTNQS--VKDVTNIQCMEL--KNEL 179
Cdd:cd15372   82 NMYCSVLLLMCISLDRYLAVVHPFFARTLRSRRFALCMCTAIWLIAAALTLP-LTLQRQSypLERLNITLCHDVlpLDEQ 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 180 GRKWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKShlkSRKNSISVKRkssrnIFSIVLVFVVCFVPYHIA-RIPYTK 258
Cdd:cd15372  161 DTYLFYYFACLAVLGFLLPLVVILFCYGSVLHTLLRS---GQRYGHAMKL-----TVLVLVSFVLCFTPSNLLlLLHYSD 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 259 SQTEGHyscqakETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15372  233 PTLDDG------GNLYIVYMVSLAISTLNSCVDPFIYYYVSEEFRD 272
7tmA_GPR68_OGR1 cd15367
G protein-coupled receptor 68, member of the class A family of seven-transmembrane G ...
26-297 5.41e-18

G protein-coupled receptor 68, member of the class A family of seven-transmembrane G protein-coupled receptors; The ovarian cancer G-protein receptor 1 (OGR1, also known as GPR68) is a member of the proton-sensing G-protein-coupled receptor (GPCR) family which also includes the G2 accumulation receptor (G2A, also known as GPR132), the T cell death associated gene-8 receptor (TDAG8, GPR65), and the G-protein-coupled receptor 4 (GPR4). Proton-sensing G-protein coupled receptors sense pH of 7.6 to 6.0 and mediates a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. Knock-out mice studies have suggested that OGR1 plays a role in the regulation of insulin secretion and glucose metabolism. OGR1 couples to G(q/11) proteins and activates phospholipase C and Ca2+ signaling pathways.


Pssm-ID: 320489  Cd Length: 276  Bit Score: 82.50  E-value: 5.41e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  26 PMLYCVVFITGVLLNGISGWI-FFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVN 104
Cdd:cd15367    4 PVVYILVLVVGLPANCLSLYYgYLQIKAKNELGIYLCNLTVADLLYIFSLPFWLQYVLQHDNWTYSELLCKICGILLYEN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 105 MYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVpNIILTNQSVKDVTN-IQCMElkNELGRKW 183
Cdd:cd15367   84 IYISIGFLCCISVDRYLAVVHPFRFHAFRTMKAATLVSTVIWLKELMTCV-FFFLHGEISKDKENhSVCFE--HYPIKAW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 184 HKASNYV-FVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKssrnIFSIVLVFVVCFVPYHIARIPYTKSQTe 262
Cdd:cd15367  161 EHNINYYrFYAGFLFPIFLLSFSYCRILRAVRKSHGTQKSQKIQIKRL----VLSTVVIFLVCFGPYHILLLVRSVFER- 235
                        250       260       270
                 ....*....|....*....|....*....|....*
gi 149064702 263 ghySCQAKETLLYTKEFTLLLSAANVCLDPIIYFF 297
Cdd:cd15367  236 ---DCNFAEGIFNYYHFSLLLTSFNCVADPVLYCF 267
7tmA_Bradykinin_R cd15189
bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled ...
24-303 7.17e-18

bradykinin receptors, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320317  Cd Length: 284  Bit Score: 82.13  E-value: 7.17e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15189    2 IIPPFIFSLCLFGLLGNLFVLLVFLLHRRRLTVAeIYLGNLAAADLVFVSGLPFWAMNILNQFNWPFGELLCRVVNGVIK 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILtnQSVKDVTNIQCME-LKNELGR 181
Cdd:cd15189   82 VNLYTSIYLLVMISQDRYLALVKTMAARRLRRRRYAKLICVLIWVVGLLLSIPTFLL--RKIKAIPDLNITAcVLLYPHE 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVF-VSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQ 260
Cdd:cd15189  160 AWHFAHIVLLnIVGFLLPLLVITFCNYNILQALRTREESTRCEDRN-DSKATALVLAVTLLFLVCWGPYHFFTFLDFLFD 238
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|...
gi 149064702 261 TEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15189  239 VGVLDECFWEHFIDIGLQLAVFLAFSNSCLNPVLYVFVGRYFR 281
7tmA_P2Y3-like cd16001
P2Y purinoceptor 3-like proteins, member of the class A family of seven-transmembrane G ...
24-296 8.31e-18

P2Y purinoceptor 3-like proteins, member of the class A family of seven-transmembrane G protein-coupled receptors; P2Y3-like proteins are an uncharacterized group that belongs to the G(i) class of a family of purinergic G-protein coupled receptors. The P2Y receptor family is composed of eight subtypes, which are activated by naturally occurring extracellular nucleotides such as ATP, ADP, UTP, UDP, and UDP-glucose. These eight receptors are ubiquitous in human tissues and can be further classified into two subfamilies based on sequence homology and second messenger coupling: a subfamily of five P2Y1-like receptors (P2Y1, P2Y2, P2Y4, P2Y6, and P2Y11Rs) that are coupled to G(q) protein to activate phospholipase C (PLC) and a second subfamily of three P2Y12-like receptors (P2Y12, P2YR13, and P2Y14Rs) that are coupled to G(i) protein to inhibit adenylate cyclase. Several cloned subtypes, such as P2Y3, P2Y5, and P2Y7-10, are not functional mammalian nucleotide receptors. The native agonists for P2Y receptors are: ATP (P2Y2, P2Y12), ADP (P2Y1, P2Y12, and P2Y13), UTP (P2Y2, P2Y4), UDP (P2Y6, P2Y14), and UDP-glucose (P2Y14).


Pssm-ID: 320667  Cd Length: 284  Bit Score: 82.12  E-value: 8.31e-18
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGW-IFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd16001    2 LLPVTYSVVFVLGLPLNGTVLWlSWCRTKRWTCSTIYLVNLAVADLLYVCSLPLLIVNYAMRDRWPFGDFLCKLVRFLFY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIqCMELKNElgRK 182
Cdd:cd16001   82 TNLYGSILFLTCISVHRFLGVCYPIRSLAYRTRRLAVIGSAATWILVVLQLLPTLVYARTGSINNRTV-CYDLTSP--DN 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNY---VFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKS 259
Cdd:cd16001  159 FGNYFPYgmvLTVTGFLIPFLIILLCYCLMIKSLIRSEEAAGVGK-AARAKSIRTILLVCGLFALCFVPFHITRTIYLFV 237
                        250       260       270
                 ....*....|....*....|....*....|....*..
gi 149064702 260 QTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYF 296
Cdd:cd16001  238 RVYLVQDCPLLQFVSLAYKIWRPLVSFNSCINPLLYF 274
7tmA_PAR2 cd15370
protease-activated receptor 2, member of the class A family of seven-transmembrane G ...
25-304 1.34e-17

protease-activated receptor 2, member of the class A family of seven-transmembrane G protein-coupled receptors; Protease-acted receptors (PARs) are seven-transmembrane proteins that belong to the class A G-protein coupled receptor (GPCR) family. Four different types of the protease-activated receptors have been identified: PAR1, PAR2, PAR3, and PAR4. PARs are predominantly expressed in platelets and are activated by serine proteases such as thrombin, trypsin, and tryptase. These proteases cleave the extracellular domain of the receptor to form a new N-terminus, which in turn functions as a tethered ligand. The newly-formed tethered ligand binds intramolecularly to activate the receptor and triggers G-protein binding and intracellular signaling. PAR1, PA3, and PAR4 are activated by thrombin, whereas PAR2 is activated by trypsin. The PARs are known to couple with several G-proteins including Gi (cAMP inhibitory), G12/13 (Rho and Ras activation), and Gq (calcium signaling) to activate downstream signaling messengers which induces numerous cellular and physiological effects.


Pssm-ID: 341349  Cd Length: 280  Bit Score: 81.38  E-value: 1.34e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKS-FIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd15370    3 LPIVYIIVFVVGLPSNAMALWVFLFRTKKKHpAVIYMANLALADLLFVIWFPLKIAYHINGNNWIYGEALCKVLIGFFYG 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPllvsIVQSVNYSKVLSVLVWVLMLLLAVPNI--ILTNQSVKdVTNIQCMELKNELGR 181
Cdd:cd15370   83 NMYCSILFMTCLSVQRYWVIVNP----MSHSRKKANIAIGISLAIWLLILLVTIplYLVKQTVF-IPALDITTCHDVLPE 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLV---FVVCFVPYHIARIPYTK 258
Cdd:cd15370  158 QLLVGDMFNYFLSLAIGVFLFPAFLTAVAYVLMIRALKSSINDESIEKKRKRAIKLIVTVlvmYLICFTPSNLLLVVHYF 237
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 259 SQTEGHyscQAKETLLYTKefTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15370  238 LLKNQG---QSSVYAFYIT--ALCLSTLNSCIDPFVYYFVSHDFRD 278
7tmA_CCR6 cd15172
CC chemokine receptor type 6, member of the class A family of seven-transmembrane G ...
25-303 4.09e-17

CC chemokine receptor type 6, member of the class A family of seven-transmembrane G protein-coupled receptors; CCR6 is the only known receptor identified for the chemokine CCL20 (also known as macrophage inflammatory protein-3alpha, MIP-3alpha). CCR6 is expressed by all mature human B cells, effector memory T-cells, and dendritic cells found in the gut mucosal immune system. CCL20 contributes to recruitment of CCR6-expressing cells to Peyer's patches and isolated lymphoid follicles in the intestine, thereby promoting the assembly and maintenance of organized lymphoid structures. Also, CCL20 expression is highly inducible in response to inflammatory signals. Thus, CCL20 is involved in both inflammatory and homeostatic functions in the immune system. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines. The CC chemokine receptors are all activating the G protein Gi.


Pssm-ID: 341330  Cd Length: 281  Bit Score: 79.80  E-value: 4.09e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGlgPWQLNVFVCRVSAVIFYV 103
Cdd:cd15172    3 VPVIYSLICVVGLIGNSLVVITYAFYKRTKSMTdVYLLNMAIADILFVLTLPFWAVYEAH--QWIFGNFSCKLLRGIYAI 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQS--VNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELK---NE 178
Cdd:cd15172   81 NFYSGMLLLACISVDRYIAIVQATKSFRLRSrtLAYSKLICAAVWLLAILISLPTFIFSEVYDFGLEEQYVCEPKypkNS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 179 LGRKWHKASNYVFVSI-FWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVkrkssrnIFSIVLVFVVCFVPYHIARIpYT 257
Cdd:cd15172  161 TAIMWKLLVLSLQVSLgFFIPLLVMIFCYSFIIKTLLQAQNSQRHKAVRV-------VVAVVLVFLVCQVPYNIVLL-IE 232
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 258 KSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15172  233 AINLGEQQSCSSEKAVAYAKTITECLAFFHCCLNPVLYAFIGVKFR 278
7tmA_BK-2 cd15381
bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled ...
26-303 4.39e-17

bradykinin receptor B2, member of the class A family of seven-transmembrane G protein-coupled receptors; The bradykinin receptor family is a group of the seven transmembrane G-protein coupled receptors, whose endogenous ligand is the pro-inflammatory nonapeptide bradykinin that mediates various vascular and pain responses. Two major bradykinin receptor subtypes, B1 and B2, have been identified based on their pharmacological properties. The B1 receptor is rapidly induced by tissue injury and inflammation, whereas the B2 receptor is ubiquitously expressed on many tissue types. Both receptors contain three consensus sites for N-linked glycosylation in extracellular domains and couple to G(q) protein to activate phospholipase C, leading to phosphoinositide hydrolysis and intracellular calcium mobilization. They can also interact with G(i) protein to inhibit adenylate cyclase and activate the MAPK (mitogen-activated protein kinase) pathways.


Pssm-ID: 320503  Cd Length: 284  Bit Score: 79.81  E-value: 4.39e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  26 PMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYVN 104
Cdd:cd15381    4 PIYLWIIFVLGTIENAFVLIVFCLHKSSCTVAeIYLGNLAAADLLLVCCLPFWAINISNGFNWPFGEFLCKSVNAVIYMN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 105 MYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNElGRKWH 184
Cdd:cd15381   84 LYSSIYFLMMVSIDRYLALVKTMSSGRMRRPACAKLNCLIIWMFGLLMSTPMIVFRTVMYFPEYNITACVLDYP-SEGWH 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 185 KASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGH 264
Cdd:cd15381  163 VALNILLNVVGFLIPLSIITFCSTQIIQVLRNNKMQKFKEIQTERKATVLVLAVLLMFFICWLPFHIFTFLDTLHKLGLI 242
                        250       260       270
                 ....*....|....*....|....*....|....*....
gi 149064702 265 YSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15381  243 SGCRWEDILDIGTQIATFLAYSNSCLNPLLYVIVGKHFR 281
7tmA_CXCR3 cd15180
CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G ...
25-306 5.60e-17

CXC chemokine receptor type 3, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR3 is an inflammatory chemotactic receptor for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. CXCR3 specifically binds three chemokines CXCL9 (monokine induced by gamma-interferon), CXCL10 (interferon induced protein of 10 kDa), and CXCL11 (interferon inducible T-cell alpha-chemoattractant, I-TAC). CXC3R is expressed on CD4+ Th1 and CD8+ cytotoxic T lymphocytes as well as highly on innate lymphocytes, such as NK cells and NK T cells, where it may mediate the recruitment of these cells to the sites of infection and inflammation. Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341335 [Multi-domain]  Cd Length: 280  Bit Score: 79.35  E-value: 5.60e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPF-KVLSDSGlgpWQLNVFVCRVSAVIFY 102
Cdd:cd15180    3 LPVLYSLVFLLGLLGNGLVLAVLLQKRRNLSVTdTFILHLALADILLLVTLPFwAVQAVHG---WIFGTGLCKLAGAVFK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIV---------KPLLVSIVQSVNYskvlsvlvwVLMLLLAVPNII-LTNQSVKDVTNIQC 172
Cdd:cd15180   80 INFYCGIFLLACISFDRYLSIVhavqmysrkKPMLVHLSCLIVW---------LFCLLLSIPDFIfLEATKDPRQNKTEC 150
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 173 MELKNELGRKWHKASNYVF-VSIFWIVFLLLTVFYMAITRKIFKSHLKSRknsisvKRKSSRNIFSIVLVFVVCFVPYHI 251
Cdd:cd15180  151 VHNFPQSDTYWWLALRLLYhIVGFLLPLAVMVYCYTSILLRLLRSSQGFQ------KQRAIRVIVAVVVVFFLCWTPYNI 224
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*.
gi 149064702 252 ARIPYTKSQTEGHYSCQAKETLLYT-KEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15180  225 ALLVDTLIDLSVLDRNCGTESRLDIaLSVTSSLGYFHCCLNPLLYAFVGVKFRRKL 280
7tmA_AT1R cd15192
type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G ...
24-304 5.90e-17

type 1 angiotensin II receptor, member of the class A family of seven-transmembrane G protein-coupled receptors; Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors. Ang II contributes to cardiovascular diseases such as hypertension and atherosclerosis via AT1R activation. Ang II increases blood pressure through Gq-mediated activation of phospholipase C, resulting in phosphoinositide (PI) hydrolysis and increased intracellular calcium levels. Through the AT2R, Ang II counteracts the vasoconstrictor action of AT1R and thereby induces vasodilation, sodium excretion, and reduction of blood pressure. Moreover, AT1R promotes cell proliferation, whereas AT2R inhibits proliferation and stimulates cell differentiation. The AT2R is highly expressed during fetal development, however it is scarcely present in adult tissues and is induced in pathological conditions. Generally, the AT1R mediates many actions of Ang II, while the AT2R is involved in the regulation of blood pressure and renal function.


Pssm-ID: 320320 [Multi-domain]  Cd Length: 285  Bit Score: 79.40  E-value: 5.90e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGIS-GWIFFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15192    2 MIPTVYSIIFVIGIFGNSLVvIVIYCYMKLKTVANIFLLNLALADLCFLITLPLWAAYTAMGYHWPFGNFLCKISSTLVS 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15192   82 FNLYASVFLLTCLSIDRYLAIVHPMKSRIRRTLVVARVTCIVIWLLAGVASLPAIIFRDVFFYENWNKTVCAFHYPNQNK 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSI--FWIVFLLLTVFYMAItrkifkshLKSRKNSISVKRKSSRN------IFSIVLVFVVCFVPYHIARI 254
Cdd:cd15192  162 QLLVGMGLMKNLlgFLIPFLIILTCYTLI--------GKTLKQAYQIQRSKSRNdeifkmIMAVVLFFFFCWIPHQVFTF 233
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|
gi 149064702 255 PYTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFRE 304
Cdd:cd15192  234 LDVLIQLKVIQNCHILEIVDTAMPFTICIAYFNSCLNPILYGFVGKNFRK 283
7tmA_CXCR1_2 cd15178
CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G ...
28-303 6.08e-17

CXC chemokine receptor types 1 and 2, member of the class A family of seven-transmembrane G protein-coupled receptors; CXCR1 and CXCR2 are closely related chemotactic receptors for a group of CXC chemokines distinguished by the presence of the amino acid motif ELR immediately adjacent to their CXC motif. Expression of CXCR1 and CXCR2 is strictly controlled in neutrophils by external stimuli such as lipopolysaccharide (LPS), tumor necrosis factor (TNF)-alpha, Toll-like receptor agonists, and nitric oxide. CXCL8 (formerly known as interleukin-8) binds with high-affinity and activates both receptors. CXCR1 also binds CXCL7 (neutrophil-activating protein-2), whereas CXCR2 non-selectively binds to all seven ELR-positive chemokines (CXCL1-7). Chemokines are principal regulators for leukocyte trafficking, recruitment, and activation. Chemokine family membership is defined on the basis of sequence homology and on the presence of variations on a conserved cysteine motif, which allows the family to further divide into four subfamilies (CC, CXC, XC, and CX3C). Chemokines interact with seven-transmembrane receptors which are typically coupled to G protein for signaling. Currently, there are ten known receptors for CC chemokines, seven for CXC chemokines, and single receptors for the XC and CX3C chemokines.


Pssm-ID: 341333 [Multi-domain]  Cd Length: 279  Bit Score: 79.24  E-value: 6.08e-17
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFkvLSDSGLGPWQLNVFVCRVSAVIFYVNMY 106
Cdd:cd15178    6 IYVLVFLLSLPGNSLVVLVILYNRRSRSSTdVYLLHLAIADLLFALTLPF--WAVSVVKGWIFGTFMCKLVSLLQEANFY 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 107 VSIAFFGLISFDRYYKIVKPLLvSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTN-IQCME-LKNELGRKWh 184
Cdd:cd15178   84 SGILLLACISVDRYLAIVHATR-ALTQKRHLVKFVCAGVWLLSLLLSLPALLNRDAFKPPNSGrTVCYEnLGNESADKW- 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 185 kasnYVFVSIFWIVF-----LLLTVFYMAIT-RKIFKSHLksrknsiSVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTK 258
Cdd:cd15178  162 ----RVVLRILRHTLgfllpLVVMLFCYGFTiKTLLQTRS-------FQKHRAMRVIFAVVLAFLLCWLPYNVTVLIDTL 230
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 149064702 259 SQTE-GHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15178  231 MRTKlITETCELRNHVDVALYVTQILGFLHSCINPVLYAFIGQKFR 276
7tmA_ACKR3_CXCR7 cd14987
CXC chemokine receptor 7, member of the class A family of seven-transmembrane G ...
25-303 1.17e-16

CXC chemokine receptor 7, member of the class A family of seven-transmembrane G protein-coupled receptors; ACKR3, also known as CXCR7, is an atypical chemokine receptor for CXCL12 and CXCR11. Unlike the classical chemokine receptors, ACKR3 contains a DRYLSIT-sequence instead of the conserved DRYLAIV motif in the second intracellular loop, which is required for G-protein coupling. Thus, ACKR3 does not activate classical GPCR signaling, instead induces beta-arrestin recruitment which is leading to ligand internalization and MAP-kinase activation. It is acting as a scavenger for CXCL12 and, to a lesser degree, for CXCL11. ACKR3 is highly expressed by blood vascular endothelial cells in brain, in numerous embryonic and neonatal tissues, in inflamed tissues and in a variety of cancers such as lymphomas, sarcomas, prostate and breast cancers, and gliomas. Five receptors have been identified for the ACKR family, including CC-Chemokine Receptors like 1 and 2 (CCRL1 and CCRL2), CXCR7, DARC, and D6. Both ACKR1 (DARC) and ACKR3 (CXCR7) show low sequence homology to the classic chemokine receptors.


Pssm-ID: 320118 [Multi-domain]  Cd Length: 282  Bit Score: 78.65  E-value: 1.17e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISGWIFFYVPSSK-SFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFYV 103
Cdd:cd14987    3 LSFFYIFIFVIGLLANSVVVWVNLQAKRTGyETHLYILNLAIADLCVVATLPVWVVSLVQHNQWPMGEFTCKITHLIFSI 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 104 NMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVTN-IQCMEL-KNELGR 181
Cdd:cd14987   83 NLFGSIFFLTCMSVDRYLSVTLFGNTSSRRKKIVRRIICVLVWLLAFVASLPDTYFLKTVTSPSNNeTYCRSFyPEESFK 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 182 KWHKASNYVFVSI-FWIVFLLLTVFYMAITRKIFKSHLKSRKNsisvkrkSSRNIFSIVLVFVVCFVPYHIARIPYTKSQ 260
Cdd:cd14987  163 EWLIGMELVSIVLgFVIPFPIIAVFYFLLARAISASSDQERKS-------SRKIIFSYVVVFLVCWLPYHTVVLLDILSF 235
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....
gi 149064702 261 TEG-HYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd14987  236 LHLiPFSCQLENFLYAALHVTQCFSLVHCCVNPILYSFINRNYR 279
7tmA_GPR174-like cd15152
putative purinergic receptor GPR174, member of the class A family of seven-transmembrane G ...
23-306 1.25e-16

putative purinergic receptor GPR174, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR174 has been recently identified as a lysophosphatidylserine receptor that enhances intracellular cAMP formation by coupling to a G(s) protein. GPR174 is a member of the rhodopsin-like, class A GPCRs, which is a widespread protein family that includes the light-sensitive rhodopsin as well as receptors for biogenic amines, lipids, nucleotides, odorants, peptide hormones, and a variety of other ligands. All GPCRs have a common structural architecture comprising of seven-transmembrane (TM) alpha-helices interconnected by three extracellular and three intracellular loops. A general feature of GPCR signaling is agonist-induced conformational changes in the receptors, leading to activation of the heterotrimeric G proteins, which consist of the guanine nucleotide-binding G-alpha subunit and the dimeric G-beta-gamma subunits. The activated G proteins then bind to and activate numerous downstream effector proteins, which generate second messengers that mediate a broad range of cellular and physiological processes.


Pssm-ID: 320280  Cd Length: 282  Bit Score: 78.61  E-value: 1.25e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  23 QIIPMLYCVVFITGVLLNGISGWIFF-YVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGlGPWQLNVFVCRVSAVIF 101
Cdd:cd15152    1 FIYAVTYTVILIPGLIGNVLALWVFYaYVKETKRAVIFMINLAIADLLQVLSLPLRIFYYLN-KSWPFGKFLCMFCFYLK 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 102 YVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVnYSKVLSVLVWVLMLLLAVPNIILtnQSVKDVTNIQC------MEL 175
Cdd:cd15152   80 YVNMYASIYFLVCISVRRCLYLIYPFRYNDCKRK-CDVYISIAGWLVVCVGCLPFPLL--RQSQDTNPTCCfadlplRNV 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 176 KNELGrkwhkASNYVFVSIFWIVFLLLTVFYMAITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIP 255
Cdd:cd15152  157 GLTTS-----VIMLTIAELTGFVTPLLIVLYCSWKTVMSLREKTPVLQDLGEKKKALKMILTCAVVFLICFAPYHISFPL 231
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|.
gi 149064702 256 YTKSQTEGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15152  232 DFLVKSNKIKSCTARKVILIFHPVALCLASLNSCLDPVIYYFTTDEFKRRL 282
7tmA_LPAR4 cd15155
lysophosphatidic acid receptor 4, member of the class A family of seven-transmembrane G ...
28-306 1.43e-16

lysophosphatidic acid receptor 4, member of the class A family of seven-transmembrane G protein-coupled receptors; Lysophosphatidic acid receptor 4 (LPAR4) is a G protein-coupled receptor that binds and is activated by the bioactive lipid lysophosphatidic acid (LPA), which is released by activated platelets and constitutively found in serum. Phylogenetic analysis of the class A GPCRs shows that LAPR4 is classified into the cluster consisting receptors that are preferentially activated by adenosine and uridine nucleotides. Although LPA6 (P2Y5) is expressed in human hair follicle cells, LPA4 and LPA5 are not. These three receptors are highly homologous and mediate an increase in intracellular cAMP production. Activation of LPAR5 is coupled to G(12/13) proteins, leading to neurite retraction and stress fiber formation, whereas coupling to G(q) protein leads to increases in calcium levels.


Pssm-ID: 320283  Cd Length: 283  Bit Score: 78.42  E-value: 1.43e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  28 LYCVVFITGVLLNGISGWIF-FYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGpWQLNVFVCRVSAVIFYVNMY 106
Cdd:cd15155    6 VYSVVFILGLITNCASLFVFcFRMKMRNETAIFMTNLAVSDLLFVFTLPFKIFYNFNRH-WPFGDSLCKISGTAFLTNIY 84
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 107 VSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDvTNIQCMELKNELGRKWHKA 186
Cdd:cd15155   85 GSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTNVSN-TSTTCFEGFSKSIWKTYLS 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 187 SNYVFVSIF-WIVFLLLTVFYMAITRKIFKSHLKSRKNSISvKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKSQTEGHY 265
Cdd:cd15155  164 KITIFIEVVgFIIPLLLNLTCSSLVLRTLRKPATLSQIGTN-KEKVLKMILVHVAIFVVCFVPYNSILFLYALVRSQAIA 242
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|.
gi 149064702 266 SCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFREVL 306
Cdd:cd15155  243 NCGVERFARTMYPITLCLATLNCCFDPFVYYFTSESFQKSF 283
7tmA_GPR65_TDAG8 cd15365
proton-sensing G protein-coupled receptor 65, member of the class A family of ...
24-298 1.81e-16

proton-sensing G protein-coupled receptor 65, member of the class A family of seven-transmembrane G protein-coupled receptors; The T cell death associated gene-8 receptor (TDAG8, also known as GPR65) is a member of the proton-sensing G-protein-coupled receptor (GPCR) family which also includes the G2 accumulation receptor (G2A, also known as GPR132), ovarian cancer G-protein receptor 1 (OGR-1, GPR68), and G-protein-coupled receptor 4 (GPR4). Proton-sensing G-protein coupled receptors sense pH of 7.6 to 6.0 and mediates a variety of biological activities in neutral and mildly acidic pH conditions, whereas the acid-sensing ionotropic ion channels typically sense strong acidic pH. Activation of TDAG8 by extracellular acidosis increases the cAMP production, stimulates Rho, and induces stress fiber formation. TDAG8 has also been shown to regulate the extracellular acidosis-induced inhibition of pro-inflammatory cytokine production in peritoneal macrophages.


Pssm-ID: 320487  Cd Length: 277  Bit Score: 77.90  E-value: 1.81e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWI-FFYVPSSKSFIIYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15365    2 LFPFVYIFVIVISIPSNCISLYVsCLQIRKKNELGVYLFNLSLSDLLYIVILPLWIDYLWNGDNWTLSGFVCIFSAFLLY 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSkvLSVLVWVLMLLLAVPNIILTNQSVKDVTNIQCMELKNELGRK 182
Cdd:cd15365   82 TNFYTSTALLTCIALDRYLAVVHPLKFMHLRTIRTA--LSVSVAIWLLEICFNAVILTWEDSFHESSSHTLCYDKFPLED 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVFymaITRKIFKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIarIPYTKSQTE 262
Cdd:cd15365  160 WQARLNLFRICLGYLLPLLIILF---CYWKIYQAVRSNQATEDQEKKKIFKLLLLITVTFVICFTPYHV--VLLIRSIVE 234
                        250       260       270
                 ....*....|....*....|....*....|....*.
gi 149064702 263 gHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFL 298
Cdd:cd15365  235 -PCDCRNAKWLYTLYKITVALTSLNCIADPFLYCFV 269
7tmA_GPR25 cd15193
G protein-coupled receptor 25, member of the class A family of seven-transmembrane G ...
24-303 2.11e-16

G protein-coupled receptor 25, member of the class A family of seven-transmembrane G protein-coupled receptors; GPR25 is an orphan G-protein coupled receptor that shares strong sequence homology to GPR15 and the angiotensin II receptors. These closely related receptors form a group within the class A G-protein coupled receptors (GPCRs). GPR15 controls homing of T cells, especially FOXP3(+) regulatory T cells, to the large intestine mucosa and thereby mediates local immune homeostasis. Moreover, GRP15-deficient mice were shown to be prone to develop more severe large intestine inflammation. Angiotensin II (Ang II), the main effector in the renin-angiotensin system, plays a crucial role in the regulation of cardiovascular homeostasis through its type 1 (AT1) and type 2 (AT2) receptors.


Pssm-ID: 320321 [Multi-domain]  Cd Length: 279  Bit Score: 77.87  E-value: 2.11e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  24 IIPMLYCVVFITGVLLNGISGWIFFYVPSSKSFI-IYLKNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVIFY 102
Cdd:cd15193    2 YIPILYLIIFFTGLLGNLFVIALMSKRSTTKRLVdTFVLNLAVADLVFVLTLPFWAASTALGGQWLFGEGLCKLSSFIIA 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 103 VNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTNQSVKDVtniqCMELKnelgrK 182
Cdd:cd15193   82 VNRCSSILFLTGMSVDRYLAVVKLLDSRPLRTRRCALITCCIIWAVSLVLGIPSLVYRNLINESV----CVEDS-----S 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 183 WHKASNYVFVSIFWIVFLLLTVF---YMAITRKIfKSHLKSRKNSISVKRKSSRNIFSIVLVFVVCFVPYHIARIPYTKS 259
Cdd:cd15193  153 SRFFQGISLATLFLTFVLPLIVIlfcYCSILVRL-RRHFHGAKRTGRRRRNSLRIVFAIVTAFVLSWLPFNTLKAVRLLL 231
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*
gi 149064702 260 QT-EGHYSCQAKETLLYTKEFTLLLSAANVCLDPIIYFFLCQPFR 303
Cdd:cd15193  232 ELgGGVLPCHTTVAIRQGLTITACLAFVNSCVNPLIYSLLDRHFR 276
7tmA_OXGR1 cd15375
2-oxoglutarate receptor 1, member of the class A family of seven-transmembrane G ...
25-306 2.48e-16

2-oxoglutarate receptor 1, member of the class A family of seven-transmembrane G protein-coupled receptors; 2-oxoglutarate receptor 1 (OXGR1) is also known as GPR80, GPR99, or P2Y15. OXGR1 functions as a receptor for alpha-ketoglutarate, a citric acid cycle intermediate, and acts exclusively through a G(q)-dependent pathway. OXGR1 belongs to the class A GPCR superfamily and is phylogenetically related to the purinergic P2Y1-like receptor subfamily, whose members are coupled to G(q) protein to activate phospholipase C (PLC). OXGR1 has also been reported as a potential third cysteinyl leukotriene receptor with specificity for leukotriene E4.


Pssm-ID: 320497  Cd Length: 280  Bit Score: 77.81  E-value: 2.48e-16
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702  25 IPMLYCVVFITGVLLNGISgwIFFYV----PSSKSFIIYLkNIVVADFLMGLTFPFKVLSDSGLGPWQLNVFVCRVSAVI 100
Cdd:cd15375    3 LPVMYSIIFIVGFPGNIIA--IFVYLfkmrPWKSSTIIML-NLALTDLLYVTSLPFLIYYYINGESWIFGEFMCKFIRFI 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 101 FYVNMYVSIAFFGLISFDRYYKIVKPLLVSIVQSVNYSKVLSVLVWVLMLLLAVPNIILTnqSVKDVTN-IQCMELKNEL 179
Cdd:cd15375   80 FHFNLYGSILFLTCFSIFRYVVIVHPLRAFQVQKRRWAIVACAVVWVISLAEVSPMTFLI--TTKEKNNrTICLDFTSSD 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 149064702 180 GRKWHKASNYVFVSI-F