NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|1323175|emb|CAA97116.1|]
View 

TY3A [Saccharomyces cerevisiae]

Protein Classification

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Retrotrans_gag super family cl04237
Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a ...
70-157 2.38e-04

Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved.


The actual alignment was detected with superfamily member pfam03732:

Pssm-ID: 309014  Cd Length: 97  Bit Score: 39.63  E-value: 2.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1323175     70 HLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQLSEAKLGIERLNQRFRKIWDRMPPDFMTEK 149
Cdd:pfam03732   6 SLEGAALTWWKSLVARSIDAFDSWDELKDAFLKRFFPSIRKDLLENELRSLRQGTESVREYVERFKRLARQLPHHGRDEE 85

                  ....*...
gi 1323175    150 AAIMTYTR 157
Cdd:pfam03732  86 ALISAFLR 93
 
Name Accession Description Interval E-value
Retrotrans_gag pfam03732
Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a ...
70-157 2.38e-04

Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved.


Pssm-ID: 309014  Cd Length: 97  Bit Score: 39.63  E-value: 2.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1323175     70 HLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQLSEAKLGIERLNQRFRKIWDRMPPDFMTEK 149
Cdd:pfam03732   6 SLEGAALTWWKSLVARSIDAFDSWDELKDAFLKRFFPSIRKDLLENELRSLRQGTESVREYVERFKRLARQLPHHGRDEE 85

                  ....*...
gi 1323175    150 AAIMTYTR 157
Cdd:pfam03732  86 ALISAFLR 93
 
Name Accession Description Interval E-value
Retrotrans_gag pfam03732
Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a ...
70-157 2.38e-04

Retrotransposon gag protein; Gag or Capsid-like proteins from LTR retrotransposons. There is a central motif QGXXEXXXXXFXXLXXH that is common to Retroviridae gag-proteins, but is poorly conserved.


Pssm-ID: 309014  Cd Length: 97  Bit Score: 39.63  E-value: 2.38e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 1323175     70 HLLNPAAQWANDFVQEQGILEITFDTFIQGLYQHFYKPPDINKIFNAITQLSEAKLGIERLNQRFRKIWDRMPPDFMTEK 149
Cdd:pfam03732   6 SLEGAALTWWKSLVARSIDAFDSWDELKDAFLKRFFPSIRKDLLENELRSLRQGTESVREYVERFKRLARQLPHHGRDEE 85

                  ....*...
gi 1323175    150 AAIMTYTR 157
Cdd:pfam03732  86 ALISAFLR 93
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH