NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|536164|emb|CAA84921.1|]
View 

TY2A [Saccharomyces cerevisiae]

Protein Classification

TYA domain-containing protein (domain architecture ID 10470239)

TYA domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.09e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


:

Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.09e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 536164      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.09e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.09e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 536164      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
PRK10263 PRK10263
DNA translocase FtsK; Provisional
9-147 3.26e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669  Cd Length: 1355  Bit Score: 46.23  E-value: 3.26e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164       9 NPHSLHGSAYASVTSKEVSSNQDPLaVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHvSPQPASVPPPQNGQYQQH 88
Cdd:PRK10263  720 NPFSLDDFEFSPMKALLDDGPHEPL-FTPIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQ-QPQQPVAPQPQYQQPQQP 797
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      89 GMMTPnkamasNWAHYQQPSmmtcshyQTSPAYYQP-DPHYPLPQYIPPLSTSSPDPIDS 147
Cdd:PRK10263  798 VAPQP------QYQQPQQPV-------APQPQYQQPqQPVAPQPQYQQPQQPVAPQPQDT 844
 
Name Accession Description Interval E-value
TYA pfam01021
TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion ...
17-114 5.09e-56

TYA transposon protein; Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. TYA a is cleaved to form 46kd protein which can form mature virion like particles.


Pssm-ID: 279373  Cd Length: 98  Bit Score: 183.36  E-value: 5.09e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      17 AYASVTSKEVSSNQDPLAVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHVSPQPASVPPPQNGQYQQHGMMTPNKA 96
Cdd:pfam01021   1 ACASVTSKEVPTNQDPLDVSASKLPEFDKDSTKANSQQETTPGSSAVPENHHHASPQPAQVPPPQNGPYQQQGMMTPNQA 80
                          90
                  ....*....|....*...
gi 536164      97 MASNWAHYQQPSMMTCSH 114
Cdd:pfam01021  81 NASGWAHYGQPSMMPYSP 98
PRK10263 PRK10263
DNA translocase FtsK; Provisional
9-147 3.26e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669  Cd Length: 1355  Bit Score: 46.23  E-value: 3.26e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164       9 NPHSLHGSAYASVTSKEVSSNQDPLaVSASNLPEFDRDSTKVNSQQETTPGTSAVPENHHHvSPQPASVPPPQNGQYQQH 88
Cdd:PRK10263  720 NPFSLDDFEFSPMKALLDDGPHEPL-FTPIVEPVQQPQQPVAPQQQYQQPQQPVAPQPQYQ-QPQQPVAPQPQYQQPQQP 797
                          90       100       110       120       130       140
                  ....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      89 GMMTPnkamasNWAHYQQPSmmtcshyQTSPAYYQP-DPHYPLPQYIPPLSTSSPDPIDS 147
Cdd:PRK10263  798 VAPQP------QYQQPQQPV-------APQPQYQQPqQPVAPQPQYQQPQQPVAPQPQDT 844
PRK10263 PRK10263
DNA translocase FtsK; Provisional
55-158 5.15e-05

DNA translocase FtsK; Provisional


Pssm-ID: 236669  Cd Length: 1355  Bit Score: 45.46  E-value: 5.15e-05
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      55 ETTPGTSAVPENHHHVSPQPasVPPPQngQYQQhgmmtPNKAMASNWaHYQQPSMMTcshyQTSPAYYQPD-PHYPLPQY 133
Cdd:PRK10263  752 VQQPQQPVAPQQQYQQPQQP--VAPQP--QYQQ-----PQQPVAPQP-QYQQPQQPV----APQPQYQQPQqPVAPQPQY 817
                          90       100
                  ....*....|....*....|....*
gi 536164     134 IPPLSTSSPDPIDSQDQHSEVPQAK 158
Cdd:PRK10263  818 QQPQQPVAPQPQYQQPQQPVAPQPQ 842
DAZAP2 pfam11029
DAZ associated protein 2 (DAZAP2); DAZ associated protein 2 has a highly conserved sequence ...
78-132 5.16e-05

DAZ associated protein 2 (DAZAP2); DAZ associated protein 2 has a highly conserved sequence throughout evolution including a conserved polyproline region and several SH2/SH3 binding sites. It occurs as a single copy gene with a four-exon organisation and is located on chromosome 12. It encodes a ubiquitously expressed protein and binds to DAZ and DAZL1 through DAZ repeats.


Pssm-ID: 314071  Cd Length: 130  Bit Score: 42.81  E-value: 5.16e-05
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|.
gi 536164      78 PPPQNGQYQQHGMMTPNKAMASN--WAHYQQPSMMTCSHYQTSP----AYYQPDPHYPLPQ 132
Cdd:pfam11029   4 YPPAYSQIYQPRYAHPPYAASYApsYGSPYPAQQMYPPMPQMGPpppmAYQPPGPMQPPPQ 64
PRK10263 PRK10263
DNA translocase FtsK; Provisional
53-155 8.67e-04

DNA translocase FtsK; Provisional


Pssm-ID: 236669  Cd Length: 1355  Bit Score: 41.61  E-value: 8.67e-04
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 536164      53 QQETTPGTSAVPENHHHVSPQPASVP-PPQNGQYQQHGMMTPNKAMASNWAHYQQPSMMTC-SHYQTSPAYYQP---DPH 127
Cdd:PRK10263  398 QQPVQPQQPYYAPAAEQPAQQPYYAPaPEQPAQQPYYAPAPEQPVAGNAWQAEEQQSTFAPqSTYQTEQTYQQPaaqEPL 477
                          90       100
                  ....*....|....*....|....*...
gi 536164     128 YPLPQYIPPLSTSSPDPIDSQDQHSEVP 155
Cdd:PRK10263  478 YQQPQPVEQQPVVEPEPVVEETKPARPP 505
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH