NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|30410985|gb|AAH51279.1|]
View 

Glypican 1 [Homo sapiens]

Protein Classification

Glypican domain-containing protein (domain architecture ID 10471748)

Glypican domain-containing protein

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
Glypican pfam01153
Glypican;
22-533 0e+00

Glypican;


:

Pssm-ID: 307347  Cd Length: 554  Bit Score: 804.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985    22 RGDPAS-KSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAML 100
Cdd:pfam01153  10 RADPASgKARSCSEVRQLYSAKGFSLNDVPQSEISGEHLRICPQGYTCCTSEMEEKLSNQSRREFEQLVHESSSSLQTTL 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   101 ATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP 180
Cdd:pfam01153  90 TTRHRKFDEFFRELLNISENSLNDMFVKTYGRLYTQNAEVFKDLFTELRRYYSGSNVNLEEALNEFWARLLERLFKLVNP 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   181 QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCL 260
Cdd:pfam01153 170 QYQFSDDYLECLSKHTEQLKPFGDVPRKLRLQVTRAFIAARAFVQGLNLGREVVNKVSQVPLSPECVRALMKMWYCPHCR 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   261 GVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVI 340
Cdd:pfam01153 250 GLPSVKPCYNYCLNVMRGCLANQADLDTEWRNFIDSLLLVAERLEGPFNIENVIDSIHVKISEAIMNMQENSMKLSAKVF 329
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   341 QGCGNPKV----NPQGPGPEEKRRRGK--LAPRERPP--SGT-LEKLVSEAKAQLRDVQDFWISLPGTLCS-EKMALSTA 410
Cdd:pfam01153 330 QGCGTPKPtpyrSRRSSKDEEKNKRGFrpYSPEERPTtaAGTrLDRLVTDVKEKLKEMKSFWSSLPDTLCSdEKMAADPT 409
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   411 SDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS 490
Cdd:pfam01153 410 NEDKCWNGQTKGRYLPEVMGNGLANQINNPEVEVDITKPDMVIRQQIMKLKIMTNRLKNAYPGNDVDFQDDSDDSSGSGS 489
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
gi 30410985   491 GDGCLDDLCGRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAAS 533
Cdd:pfam01153 490 GDGCPSDDCKGDLPIVFPATDTPATPARPTTRNGTGSRDGSST 532
 
Name Accession Description Interval E-value
Glypican pfam01153
Glypican;
22-533 0e+00

Glypican;


Pssm-ID: 307347  Cd Length: 554  Bit Score: 804.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985    22 RGDPAS-KSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAML 100
Cdd:pfam01153  10 RADPASgKARSCSEVRQLYSAKGFSLNDVPQSEISGEHLRICPQGYTCCTSEMEEKLSNQSRREFEQLVHESSSSLQTTL 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   101 ATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP 180
Cdd:pfam01153  90 TTRHRKFDEFFRELLNISENSLNDMFVKTYGRLYTQNAEVFKDLFTELRRYYSGSNVNLEEALNEFWARLLERLFKLVNP 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   181 QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCL 260
Cdd:pfam01153 170 QYQFSDDYLECLSKHTEQLKPFGDVPRKLRLQVTRAFIAARAFVQGLNLGREVVNKVSQVPLSPECVRALMKMWYCPHCR 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   261 GVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVI 340
Cdd:pfam01153 250 GLPSVKPCYNYCLNVMRGCLANQADLDTEWRNFIDSLLLVAERLEGPFNIENVIDSIHVKISEAIMNMQENSMKLSAKVF 329
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   341 QGCGNPKV----NPQGPGPEEKRRRGK--LAPRERPP--SGT-LEKLVSEAKAQLRDVQDFWISLPGTLCS-EKMALSTA 410
Cdd:pfam01153 330 QGCGTPKPtpyrSRRSSKDEEKNKRGFrpYSPEERPTtaAGTrLDRLVTDVKEKLKEMKSFWSSLPDTLCSdEKMAADPT 409
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   411 SDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS 490
Cdd:pfam01153 410 NEDKCWNGQTKGRYLPEVMGNGLANQINNPEVEVDITKPDMVIRQQIMKLKIMTNRLKNAYPGNDVDFQDDSDDSSGSGS 489
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
gi 30410985   491 GDGCLDDLCGRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAAS 533
Cdd:pfam01153 490 GDGCPSDDCKGDLPIVFPATDTPATPARPTTRNGTGSRDGSST 532
 
Name Accession Description Interval E-value
Glypican pfam01153
Glypican;
22-533 0e+00

Glypican;


Pssm-ID: 307347  Cd Length: 554  Bit Score: 804.28  E-value: 0e+00
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985    22 RGDPAS-KSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLRICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAML 100
Cdd:pfam01153  10 RADPASgKARSCSEVRQLYSAKGFSLNDVPQSEISGEHLRICPQGYTCCTSEMEEKLSNQSRREFEQLVHESSSSLQTTL 89
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   101 ATQLRSFDDHFQHLLNDSERTLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP 180
Cdd:pfam01153  90 TTRHRKFDEFFRELLNISENSLNDMFVKTYGRLYTQNAEVFKDLFTELRRYYSGSNVNLEEALNEFWARLLERLFKLVNP 169
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   181 QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQVPLGPECSRAVMKLVYCAHCL 260
Cdd:pfam01153 170 QYQFSDDYLECLSKHTEQLKPFGDVPRKLRLQVTRAFIAARAFVQGLNLGREVVNKVSQVPLSPECVRALMKMWYCPHCR 249
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   261 GVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLITDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVI 340
Cdd:pfam01153 250 GLPSVKPCYNYCLNVMRGCLANQADLDTEWRNFIDSLLLVAERLEGPFNIENVIDSIHVKISEAIMNMQENSMKLSAKVF 329
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   341 QGCGNPKV----NPQGPGPEEKRRRGK--LAPRERPP--SGT-LEKLVSEAKAQLRDVQDFWISLPGTLCS-EKMALSTA 410
Cdd:pfam01153 330 QGCGTPKPtpyrSRRSSKDEEKNKRGFrpYSPEERPTtaAGTrLDRLVTDVKEKLKEMKSFWSSLPDTLCSdEKMAADPT 409
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30410985   411 SDDRCWNGMARGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQDASDDGSGSGS 490
Cdd:pfam01153 410 NEDKCWNGQTKGRYLPEVMGNGLANQINNPEVEVDITKPDMVIRQQIMKLKIMTNRLKNAYPGNDVDFQDDSDDSSGSGS 489
                         490       500       510       520
                  ....*....|....*....|....*....|....*....|...
gi 30410985   491 GDGCLDDLCGRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAAS 533
Cdd:pfam01153 490 GDGCPSDDCKGDLPIVFPATDTPATPARPTTRNGTGSRDGSST 532
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH