NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|408536126|pdb|4HAD|D]
View 

Protein Classification

gfo/Idh/MocA family oxidoreductase (domain architecture ID 11430574)

gfo/Idh/MocA family oxidoreductase belonging to the NAD(P)(+)-binding Rossmann-fold superfamily catalyzes the transfer of electrons from one molecule, the electron donor or reductant, to another molecule, the electron acceptor or oxidant

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
MviM COG0673
Predicted dehydrogenase [General function prediction only];
24-350 6.71e-75

Predicted dehydrogenase [General function prediction only];


:

Pssm-ID: 223745  Cd Length: 342  Bit Score: 238.22  E-value: 6.71e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D       24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HAD_D      334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
 
Name Accession Description Interval E-value
MviM COG0673
Predicted dehydrogenase [General function prediction only];
24-350 6.71e-75

Predicted dehydrogenase [General function prediction only];


Pssm-ID: 223745  Cd Length: 342  Bit Score: 238.22  E-value: 6.71e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D       24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HAD_D      334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
myo_inos_iolG TIGR04380
inositol 2-dehydrogenase; All members of the seed alignment for this model are known or ...
24-326 6.80e-28

inositol 2-dehydrogenase; All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]


Pssm-ID: 275173  Cd Length: 330  Bit Score: 111.93  E-value: 6.80e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D         24 LRFGIISTAKIGR---DNVVPAIQDAEncvVTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHI 100
Cdd:TIGR04380   2 LKVGIIGAGRIGKvhaENLATHVPGAR---LKAIVDPFADAAAELAEKLGIEPVTQDPEAALADPEIDAVLIASPTDTHA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        101 EWSIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGaftyFNRD 180
Cdd:TIGR04380  79 DLIIEAAAAGKHIFCEKPIDLDLEEIKEALAAVEKAGVKLQIGFNRRFDPNFRRVKQLVEAGKIGKPEILRI----TSRD 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        181 asn*rniPELG--------GGGLPDIGVYPV*STRFSTGKEPLRIQANTER--DPDFGtdiyssvkaDFDDFELSFyVST 250
Cdd:TIGR04380 155 -------PAPPpvayvkvsGGLFLDMTIHDFDMARFLLGSEVEEVYAQGSVlvDPAIG---------EAGDVDTAV-ITL 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        251 Q*ANRQI*VF----------------HGTNGYI--EVKSPFNANRWGPEEIeLADRSHNesrIF--RFQDSrqYRREVEA 310
Cdd:TIGR04380 218 KFENGAIAVIdnsrraaygydqrvevFGSKGMLraENDTESTVILYDAEGV-RGDKPLN---FFleRYRDA--YRAEIQA 291
                         330
                  ....*....|....*.
4HAD_D        311 FARAVENGKEEVVTLE 326
Cdd:TIGR04380 292 FVDAILEGRPPPVTGE 307
GFO_IDH_MocA pfam01408
Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. ...
24-144 2.60e-23

Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 279716  Cd Length: 120  Bit Score: 94.19  E-value: 2.60e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D         24 LRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRARE*ADRFSVPhAFGSYEE*LASDVIDAVYIPLPTSQHIEWS 103
Cdd:pfam01408   1 LRVGIIGAGKIGRRHARPLNESQDGEELVGILDPDSERAEAVAESFGVP-AYSDLEELLADPEIDAVIVATPNGLHYDLA 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
4HAD_D        104 IKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY 144
Cdd:pfam01408  80 LAALEAGKHVLCEKPLATTVEEAKELVELARKKGVRVSVGY 120
PRK11579 PRK11579
putative oxidoreductase; Provisional
41-177 3.90e-06

putative oxidoreductase; Provisional


Pssm-ID: 183212  Cd Length: 346  Bit Score: 47.79  E-value: 3.90e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        41 PAIQDAENCVVTAIASRDLTRARe*ADRFSVPHAfgSYEE*LASD-VIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPL 119
Cdd:PRK11579  22 PLIAGTPGLELAAVSSSDATKVK--ADWPTVTVV--SEPQHLFNDpNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPF 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
4HAD_D       120 AL---KAGDIDAViaARDRNKVVvteay*ITYSPVWQK----VRSLIDEGAIGSLRHVQGAFTYF 177
Cdd:PRK11579  98 TVtlsQARELDAL--AKSAGRVL-----SVFHNRRWDSdfltLKALLAEGVLGEVAYFESHFDRF 155
 
Name Accession Description Interval E-value
MviM COG0673
Predicted dehydrogenase [General function prediction only];
24-350 6.71e-75

Predicted dehydrogenase [General function prediction only];


Pssm-ID: 223745  Cd Length: 342  Bit Score: 238.22  E-value: 6.71e-75
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D       24 LRFGIISTAKIGRDNVVPAIQDAENCV-VTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEW 102
Cdd:COG0673   4 IRVGIIGAGGIAGKAHLPALAALGGGLeLVAVVDRDPERAEAFAEEFGIAKAYTDLEELLADPDIDAVYIATPNALHAEL 83
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      103 SIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDAS 182
Cdd:COG0673  84 ALAALEAGKHVLCEKPLALTLEEAEELVELARKAGVKLMVGFNRRFDPAVQALKELIDSGALGEVVSVQASFSRDRPNPP 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      183 N*---RNIPELGGGGLPDIGVYPV*STRFSTGK-EPLRIQANTERDP--DFGTDIYSSVKADFDD--FELSFYVSTQ*AN 254
Cdd:COG0673 164 PPpwwRFDRADGGGALLDLGIHDLDLLRFLLGSpEPVSVSAKARNSPpgEAGVDDSASAILRFENgvLAVSWASRTAAGG 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D      255 RQI*V-FHGTNGYIEVKSPFNANRWGPEEIELADRSHNESRIFRFQDSRQYRREVEAFARAVENGKEEVVTLENSKLNQK 333
Cdd:COG0673 244 YDVRLeVYGTKGSLEVDDGNPTGELLDGRIGLDVRGGDGELLLVPRRGNPYEGELEAFADAIRGGGEPLVSGEDALKALR 323
                       330
                ....*....|....*..
4HAD_D      334 VIDAIYRASEKDGWEAV 350
Cdd:COG0673 324 LAEAAYESAKEGRTVKL 340
myo_inos_iolG TIGR04380
inositol 2-dehydrogenase; All members of the seed alignment for this model are known or ...
24-326 6.80e-28

inositol 2-dehydrogenase; All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]


Pssm-ID: 275173  Cd Length: 330  Bit Score: 111.93  E-value: 6.80e-28
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D         24 LRFGIISTAKIGR---DNVVPAIQDAEncvVTAIASRDLTRARE*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHI 100
Cdd:TIGR04380   2 LKVGIIGAGRIGKvhaENLATHVPGAR---LKAIVDPFADAAAELAEKLGIEPVTQDPEAALADPEIDAVLIASPTDTHA 78
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        101 EWSIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY*ITYSPVWQKVRSLIDEGAIGSLRHVQGaftyFNRD 180
Cdd:TIGR04380  79 DLIIEAAAAGKHIFCEKPIDLDLEEIKEALAAVEKAGVKLQIGFNRRFDPNFRRVKQLVEAGKIGKPEILRI----TSRD 154
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        181 asn*rniPELG--------GGGLPDIGVYPV*STRFSTGKEPLRIQANTER--DPDFGtdiyssvkaDFDDFELSFyVST 250
Cdd:TIGR04380 155 -------PAPPpvayvkvsGGLFLDMTIHDFDMARFLLGSEVEEVYAQGSVlvDPAIG---------EAGDVDTAV-ITL 217
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        251 Q*ANRQI*VF----------------HGTNGYI--EVKSPFNANRWGPEEIeLADRSHNesrIF--RFQDSrqYRREVEA 310
Cdd:TIGR04380 218 KFENGAIAVIdnsrraaygydqrvevFGSKGMLraENDTESTVILYDAEGV-RGDKPLN---FFleRYRDA--YRAEIQA 291
                         330
                  ....*....|....*.
4HAD_D        311 FARAVENGKEEVVTLE 326
Cdd:TIGR04380 292 FVDAILEGRPPPVTGE 307
GFO_IDH_MocA pfam01408
Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. ...
24-144 2.60e-23

Oxidoreductase family, NAD-binding Rossmann fold; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 279716  Cd Length: 120  Bit Score: 94.19  E-value: 2.60e-23
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D         24 LRFGIISTAKIGRDNVVPAIQDAENCVVTAIASRDLTRARE*ADRFSVPhAFGSYEE*LASDVIDAVYIPLPTSQHIEWS 103
Cdd:pfam01408   1 LRVGIIGAGKIGRRHARPLNESQDGEELVGILDPDSERAEAVAESFGVP-AYSDLEELLADPEIDAVIVATPNGLHYDLA 79
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|.
4HAD_D        104 IKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEAY 144
Cdd:pfam01408  80 LAALEAGKHVLCEKPLATTVEEAKELVELARKKGVRVSVGY 120
PRK11579 PRK11579
putative oxidoreductase; Provisional
41-177 3.90e-06

putative oxidoreductase; Provisional


Pssm-ID: 183212  Cd Length: 346  Bit Score: 47.79  E-value: 3.90e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        41 PAIQDAENCVVTAIASRDLTRARe*ADRFSVPHAfgSYEE*LASD-VIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPL 119
Cdd:PRK11579  22 PLIAGTPGLELAAVSSSDATKVK--ADWPTVTVV--SEPQHLFNDpNIDLIVIPTPNDTHFPLAKAALEAGKHVVVDKPF 97
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
4HAD_D       120 AL---KAGDIDAViaARDRNKVVvteay*ITYSPVWQK----VRSLIDEGAIGSLRHVQGAFTYF 177
Cdd:PRK11579  98 TVtlsQARELDAL--AKSAGRVL-----SVFHNRRWDSdfltLKALLAEGVLGEVAYFESHFDRF 155
PRK10206 PRK10206
putative oxidoreductase; Provisional
64-191 5.96e-03

putative oxidoreductase; Provisional


Pssm-ID: 182305  Cd Length: 344  Bit Score: 37.88  E-value: 5.96e-03
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
4HAD_D        64 E*ADRFSVPHAFGSYEE*LASDVIDAVYIPLPTSQHIEWSIKAADAGKHVVCEKPLALKAGDIDAVIAARDRNKVVVTEA 143
Cdd:PRK10206  42 EQAPIYSHIHFTSDLDEVLNDPDVKLVVVCTHADSHFEYAKRALEAGKNVLVEKPFTPTLAEAKELFALAKSKGLTVTPY 121
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
4HAD_D       144 Y*ITYSPVWQKVRSLIDEGAIGSLRHVQGAFTYFNRDASN*RNIPELG 191
Cdd:PRK10206 122 QNRRFDSCFLTAKKAIESGKLGEIVEVESHFDYYRPVAETKPGLPQDG 169
GFO_IDH_MocA_C pfam02894
Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or ...
156-219 7.14e-03

Oxidoreductase family, C-terminal alpha/beta domain; This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.


Pssm-ID: 280967  Cd Length: 114  Bit Score: 35.88  E-value: 7.14e-03
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*..
4HAD_D        156 RSLIDEGAIGSLRHVQGAFTYFNR---DASN*RNIPELGGGGLPDIGVYPV*STRFSTGKEPLRIQA 219
Cdd:pfam02894   1 KELIENGVLGEVLMVHVHFRIDRAgrpYKWRWKGDKEKGGGALGDLGIHTLDLLHYLFGSPPSVVAA 67
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH