NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568065|pdb|2XG2|N]
View 

Protein Classification

50S ribosomal protein L13 (domain architecture ID 10793167)

50S ribosomal protein L13 is important during the early stages of 50S assembly

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplM PRK09216
50S ribosomal protein L13; Reviewed
1-140 6.33e-92

50S ribosomal protein L13; Reviewed


:

Pssm-ID: 181703  Cd Length: 144  Bit Score: 266.16  E-value: 6.33e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         1 MKTYVPK--QVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:PRK09216   1 MKTFSAKpaEVERKWYVIDAEGKVLGRLASEVASILRGKHKPTFTPHVDTGDFVIVINAEKVKLTGKKLTDKIYYRHSGY 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
2XG2_N        79 PGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:PRK09216  81 PGGLKEITFGELLAKKPERVIEKAVKGMLPKNPLGRAMFKKLKVYAGAEHPHAAQQPEVLEI 142
 
Name Accession Description Interval E-value
rplM PRK09216
50S ribosomal protein L13; Reviewed
1-140 6.33e-92

50S ribosomal protein L13; Reviewed


Pssm-ID: 181703  Cd Length: 144  Bit Score: 266.16  E-value: 6.33e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         1 MKTYVPK--QVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:PRK09216   1 MKTFSAKpaEVERKWYVIDAEGKVLGRLASEVASILRGKHKPTFTPHVDTGDFVIVINAEKVKLTGKKLTDKIYYRHSGY 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
2XG2_N        79 PGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:PRK09216  81 PGGLKEITFGELLAKKPERVIEKAVKGMLPKNPLGRAMFKKLKVYAGAEHPHAAQQPEVLEI 142
Ribosomal_L13 pfam00572
Ribosomal protein L13;
12-137 4.59e-82

Ribosomal protein L13;


Pssm-ID: 306943  Cd Length: 126  Bit Score: 240.70  E-value: 4.59e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         12 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKML 91
Cdd:pfam00572   1 KWYVIDAEGQVLGRLASKIAKILRGKHKPIYTPHVDCGDYVIVINADKVALTGKKWDQKVYYRHTGYPGGLKETTAKELL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
2XG2_N         92 ATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEK 137
Cdd:pfam00572  81 EKDPERIIEKAVKGMLPKNRLGRRMLKKLKVYAGSEHPHEAQKPEV 126
rplM_bact TIGR01066
ribosomal protein L13, bacterial type; This model distinguishes ribosomal protein L13 of ...
6-140 2.27e-74

ribosomal protein L13, bacterial type; This model distinguishes ribosomal protein L13 of bacteria and organelles from its eukarytotic and archaeal counterparts. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 162186  Cd Length: 140  Bit Score: 221.80  E-value: 2.27e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N          6 PKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKI 85
Cdd:TIGR01066   6 SDDKKRKWYVVDAAGKTLGRLASEVARLLRGKHKPTYTPHVDCGDYVIVINAEKVRLTGKKLEQKVYYRHSGYPGGLKSR 85
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
2XG2_N         86 PLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:TIGR01066  86 TFEEMIARKPERVLEHAVKGMLPKNRLGRKLFKKLKVYAGSEHPHEAQKPIVLDI 140
RplM COG0102
Ribosomal protein L13 [Translation, ribosomal structure and biogenesis];
1-140 3.67e-69

Ribosomal protein L13 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223180  Cd Length: 148  Bit Score: 208.65  E-value: 3.67e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N        1 MKTYVPK--QVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:COG0102   1 MKTFTAKpsEVERKWYVIDAEGKVLGRLASEVAKRLRGKHKPTYTPHVDTGDYVIVINAEKVVITGKKLTDKKYYRHSGY 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
2XG2_N       79 PGGLKKIPLEKMLAT-HPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:COG0102  81 PGGLKNPTRGGPLAPrRPERILERAVRGMLPKNPLGRAALKRLKVYAGIPHPHEAQKPEALEL 143
Ribosomal_L13 cd00392
Ribosomal protein L13. Protein L13, a large ribosomal subunit protein, is one of five ...
13-126 6.99e-61

Ribosomal protein L13. Protein L13, a large ribosomal subunit protein, is one of five proteins required for an early folding intermediate of 23S rRNA in the assembly of the large subunit. L13 is situated on the bottom of the large subunit, near the polypeptide exit site. It interacts with proteins L3 and L6, and forms an extensive network of interactions with 23S rRNA. L13 has been identified as a homolog of the human breast basic conserved protein 1 (BBC1), a protein identified through its increased expression in breast cancer. L13 expression is also upregulated in a variety of human gastrointestinal cancers, suggesting it may play a role in the etiology of a variety of human malignancies.


Pssm-ID: 238230  Cd Length: 114  Bit Score: 186.17  E-value: 6.99e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N       13 WVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLA 92
Cdd:cd00392   1 WHVIDAKGQVLGRLASKVAKLLLGKHKPTYTPHVDCGDYVVVVNAEKIVITGKKWRQKVYYRHTGYPGGLKNPTAGPLHP 80
                        90       100       110
                ....*....|....*....|....*....|....
2XG2_N       93 THPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGP 126
Cdd:cd00392  81 RAPERILKRAVRGMLPKNKLGRAALKRLKVYEGA 114
 
Name Accession Description Interval E-value
rplM PRK09216
50S ribosomal protein L13; Reviewed
1-140 6.33e-92

50S ribosomal protein L13; Reviewed


Pssm-ID: 181703  Cd Length: 144  Bit Score: 266.16  E-value: 6.33e-92
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         1 MKTYVPK--QVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:PRK09216   1 MKTFSAKpaEVERKWYVIDAEGKVLGRLASEVASILRGKHKPTFTPHVDTGDFVIVINAEKVKLTGKKLTDKIYYRHSGY 80
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
2XG2_N        79 PGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:PRK09216  81 PGGLKEITFGELLAKKPERVIEKAVKGMLPKNPLGRAMFKKLKVYAGAEHPHAAQQPEVLEI 142
Ribosomal_L13 pfam00572
Ribosomal protein L13;
12-137 4.59e-82

Ribosomal protein L13;


Pssm-ID: 306943  Cd Length: 126  Bit Score: 240.70  E-value: 4.59e-82
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         12 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKML 91
Cdd:pfam00572   1 KWYVIDAEGQVLGRLASKIAKILRGKHKPIYTPHVDCGDYVIVINADKVALTGKKWDQKVYYRHTGYPGGLKETTAKELL 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*.
2XG2_N         92 ATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEK 137
Cdd:pfam00572  81 EKDPERIIEKAVKGMLPKNRLGRRMLKKLKVYAGSEHPHEAQKPEV 126
rplM_bact TIGR01066
ribosomal protein L13, bacterial type; This model distinguishes ribosomal protein L13 of ...
6-140 2.27e-74

ribosomal protein L13, bacterial type; This model distinguishes ribosomal protein L13 of bacteria and organelles from its eukarytotic and archaeal counterparts. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 162186  Cd Length: 140  Bit Score: 221.80  E-value: 2.27e-74
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N          6 PKQVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKI 85
Cdd:TIGR01066   6 SDDKKRKWYVVDAAGKTLGRLASEVARLLRGKHKPTYTPHVDCGDYVIVINAEKVRLTGKKLEQKVYYRHSGYPGGLKSR 85
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|....*
2XG2_N         86 PLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:TIGR01066  86 TFEEMIARKPERVLEHAVKGMLPKNRLGRKLFKKLKVYAGSEHPHEAQKPIVLDI 140
RplM COG0102
Ribosomal protein L13 [Translation, ribosomal structure and biogenesis];
1-140 3.67e-69

Ribosomal protein L13 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223180  Cd Length: 148  Bit Score: 208.65  E-value: 3.67e-69
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N        1 MKTYVPK--QVEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:COG0102   1 MKTFTAKpsEVERKWYVIDAEGKVLGRLASEVAKRLRGKHKPTYTPHVDTGDYVIVINAEKVVITGKKLTDKKYYRHSGY 80
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|...
2XG2_N       79 PGGLKKIPLEKMLAT-HPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:COG0102  81 PGGLKNPTRGGPLAPrRPERILERAVRGMLPKNPLGRAALKRLKVYAGIPHPHEAQKPEALEL 143
rpl13 CHL00159
ribosomal protein L13; Validated
1-140 9.80e-66

ribosomal protein L13; Validated


Pssm-ID: 177072  Cd Length: 143  Bit Score: 199.83  E-value: 9.80e-66
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         1 MKTYVPKQ--VEPRWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGY 78
Cdd:CHL00159   2 NKTFIPSKdyKNRKWYIIDAKDQTLGRLATKIASLLRGKNKPSYHPSVDTGDYVIVINAEKIKVTGNKTSQKFYVRHSGR 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|..
2XG2_N        79 PGGLKKIPLEKMLATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHPHQAQRPEKLEV 140
Cdd:CHL00159  82 PGGLKIETFEELQNRLPNRIIEKAVKGMLPKGPLGRKLFTKLKVYKGESHPHVAQKPIKINI 143
Ribosomal_L13 cd00392
Ribosomal protein L13. Protein L13, a large ribosomal subunit protein, is one of five ...
13-126 6.99e-61

Ribosomal protein L13. Protein L13, a large ribosomal subunit protein, is one of five proteins required for an early folding intermediate of 23S rRNA in the assembly of the large subunit. L13 is situated on the bottom of the large subunit, near the polypeptide exit site. It interacts with proteins L3 and L6, and forms an extensive network of interactions with 23S rRNA. L13 has been identified as a homolog of the human breast basic conserved protein 1 (BBC1), a protein identified through its increased expression in breast cancer. L13 expression is also upregulated in a variety of human gastrointestinal cancers, suggesting it may play a role in the etiology of a variety of human malignancies.


Pssm-ID: 238230  Cd Length: 114  Bit Score: 186.17  E-value: 6.99e-61
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N       13 WVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKMLA 92
Cdd:cd00392   1 WHVIDAKGQVLGRLASKVAKLLLGKHKPTYTPHVDCGDYVVVVNAEKIVITGKKWRQKVYYRHTGYPGGLKNPTAGPLHP 80
                        90       100       110
                ....*....|....*....|....*....|....
2XG2_N       93 THPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGP 126
Cdd:cd00392  81 RAPERILKRAVRGMLPKNKLGRAALKRLKVYEGA 114
PLN00205 PLN00205
ribisomal protein L13 family protein; Provisional
12-129 2.22e-31

ribisomal protein L13 family protein; Provisional


Pssm-ID: 177795  Cd Length: 191  Bit Score: 113.02  E-value: 2.22e-31
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N        12 RWVLIDAEGKTLGRLATKIATLLRGKHRPDWTPNVAMGDFVVVVNADKIRVTGKKLEQKIYTRYSGYPGGLKKIPLEKML 91
Cdd:PLN00205  16 RWRVFDAKGQVLGRLASQISTVLQGKDKPTYAPNRDDGDICIVLNAKDISVTGRKLTDKFYRWHTGYIGHLKERSLKDQM 95
                         90       100       110
                 ....*....|....*....|....*....|....*...
2XG2_N        92 ATHPERVLEHAVKGMLPKGPLGRRLFKRLKVYAGPDHP 129
Cdd:PLN00205  96 AKDPTEVIRKAVLRMLPRNRLRDDRDRKLRIFAGSEHP 133
rpl13p PRK06394
50S ribosomal protein L13P; Reviewed
14-125 4.75e-15

50S ribosomal protein L13P; Reviewed


Pssm-ID: 235793  Cd Length: 146  Bit Score: 68.36  E-value: 4.75e-15
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N        14 VLIDAEGKTLGRLATKIATLLrgkhrpdwtpnvAMGDFVVVVNADKIRVTGK--------KLEQKIYTRYSGYPGGlKKI 85
Cdd:PRK06394   5 VVIDAEGQILGRLASYVAKRL------------LEGEEVVIVNAEKAVITGNrerviekyKQRRERGSHYNPYRNG-PKY 71
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|.
2XG2_N        86 PlekmlaTHPERVLEHAVKGMLP-KGPLGRRLFKRLKVYAG 125
Cdd:PRK06394  72 P------RRPDRIFKRTIRGMLPyKKPRGREALKRLKVYVG 106
L13_A_E TIGR01077
ribosomal protein uL13, archaeal/eukaryotic form; This model represents ribosomal protein of ...
14-139 3.34e-13

ribosomal protein uL13, archaeal/eukaryotic form; This model represents ribosomal protein of L13 from the Archaea and from the eukaryotic cytosol. Bacterial and organellar forms are represented by model TIGR01066. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 162192  Cd Length: 142  Bit Score: 63.22  E-value: 3.34e-13
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N         14 VLIDAEGKTLGRLATKIATLLrgkhrpdwtpnvAMGDFVVVVNADKIRVTGKKleQKIYTRYSGYPGGLKKIPLEK--ML 91
Cdd:TIGR01077   1 TVIDGSGHILGRLASVVAKQL------------LNGEKVVVVNAEKIVISGNF--YRNKLKYKEFLRKRTLTNPRRgpFF 66
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*....
2XG2_N         92 ATHPERVLEHAVKGMLP-KGPLGRRLFKRLKVYAGPDHPHQAQRPEKLE 139
Cdd:TIGR01077  67 PRAPSRIFRRTVRGMLPhKTARGRAALRRLKVYVGIPPELDKKKRVVVP 115
PTZ00068 PTZ00068
60S ribosomal protein L13a; Provisional
11-129 2.27e-05

60S ribosomal protein L13a; Provisional


Pssm-ID: 240253  Cd Length: 202  Bit Score: 41.96  E-value: 2.27e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG2_N        11 PRWVLIDAEGKTLGRLATKIA-TLLRGKHrpdwtpnvamgdfVVVVNADKIRVTGKKLEQKI-YTRYsgypgglkkipLE 88
Cdd:PTZ00068   3 KKVIVIDCKGHLLGRLASVVAkELLLGQK-------------IVVVRCEDLNISGSLFRNKVkYEEF-----------LR 58
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|..
2XG2_N        89 KMLATHPER----------VLEHAVKGMLP-KGPLGRRLFKRLKVYAGPDHP 129
Cdd:PTZ00068  59 KRMNTNPRRgpfhhrapsdIFWRTVRGMLPhKTKRGAAALKRLKVFEGVPAP 110
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH