NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568027|pdb|2XG1|H]
View 

Protein Classification

30S ribosomal protein S8 (domain architecture ID 10011269)

30S ribosomal protein S8 binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rpsH PRK00136
30S ribosomal protein S8; Validated
1-138 7.88e-79

30S ribosomal protein S8; Validated


:

Pssm-ID: 234658  Cd Length: 130  Bit Score: 231.48  E-value: 7.88e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRrqgpdprpEQVI 80
Cdd:PRK00136   1 SMTDPIADMLTRIRNAQMAKHETVSMPASKLKVAIAEILKEEGYIKDYEVEEDGKQGILRITLKYGEG--------EPVI 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H        81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:PRK00136  73 EGIKRVSKPGLRVYKKKDELPKVLNGLGIAIVSTSKGVMTDREARKAGVGGEVLCYVW 130
 
Name Accession Description Interval E-value
rpsH PRK00136
30S ribosomal protein S8; Validated
1-138 7.88e-79

30S ribosomal protein S8; Validated


Pssm-ID: 234658  Cd Length: 130  Bit Score: 231.48  E-value: 7.88e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRrqgpdprpEQVI 80
Cdd:PRK00136   1 SMTDPIADMLTRIRNAQMAKHETVSMPASKLKVAIAEILKEEGYIKDYEVEEDGKQGILRITLKYGEG--------EPVI 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H        81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:PRK00136  73 EGIKRVSKPGLRVYKKKDELPKVLNGLGIAIVSTSKGVMTDREARKAGVGGEVLCYVW 130
Ribosomal_S8 pfam00410
Ribosomal protein S8;
6-138 3.99e-69

Ribosomal protein S8;


Pssm-ID: 278821  Cd Length: 125  Bit Score: 206.44  E-value: 3.99e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H          6 IADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRrqgpdprpEQVIHHIRR 85
Cdd:pfam00410   1 IADMLTRIRNASRARKRTVSIPASKLKLAILKVLKEEGYISSFEVIDDGGKRRLWLGLKYNKG--------CPVISKLKR 72
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
2XG1_H         86 ISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:pfam00410  73 ISKPGRRVYVSADELPRVLNGLGIAIVSTSKGVMTDREARKKGVGGEVLCYVW 125
RpsH COG0096
Ribosomal protein S8 [Translation, ribosomal structure and biogenesis];
1-138 6.24e-64

Ribosomal protein S8 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223174  Cd Length: 132  Bit Score: 193.52  E-value: 6.24e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H        1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGpdprpeqVI 80
Cdd:COG0096   2 MMTDPLADMLTRIRNAERAKKEVVSMPASKLKGAILKVLKKEGYIKDFEVIDDGRKGKLRVQLKYRINGCG-------VI 74
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H       81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:COG0096  75 SPIKRVSKPGLRVYEKKRELPAVLNGLGIAIVSTSKGVMTDKEARKKGVGGEVLCYVW 132
 
Name Accession Description Interval E-value
rpsH PRK00136
30S ribosomal protein S8; Validated
1-138 7.88e-79

30S ribosomal protein S8; Validated


Pssm-ID: 234658  Cd Length: 130  Bit Score: 231.48  E-value: 7.88e-79
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRrqgpdprpEQVI 80
Cdd:PRK00136   1 SMTDPIADMLTRIRNAQMAKHETVSMPASKLKVAIAEILKEEGYIKDYEVEEDGKQGILRITLKYGEG--------EPVI 72
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H        81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:PRK00136  73 EGIKRVSKPGLRVYKKKDELPKVLNGLGIAIVSTSKGVMTDREARKAGVGGEVLCYVW 130
Ribosomal_S8 pfam00410
Ribosomal protein S8;
6-138 3.99e-69

Ribosomal protein S8;


Pssm-ID: 278821  Cd Length: 125  Bit Score: 206.44  E-value: 3.99e-69
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H          6 IADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRrqgpdprpEQVIHHIRR 85
Cdd:pfam00410   1 IADMLTRIRNASRARKRTVSIPASKLKLAILKVLKEEGYISSFEVIDDGGKRRLWLGLKYNKG--------CPVISKLKR 72
                          90       100       110       120       130
                  ....*....|....*....|....*....|....*....|....*....|...
2XG1_H         86 ISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:pfam00410  73 ISKPGRRVYVSADELPRVLNGLGIAIVSTSKGVMTDREARKKGVGGEVLCYVW 125
RpsH COG0096
Ribosomal protein S8 [Translation, ribosomal structure and biogenesis];
1-138 6.24e-64

Ribosomal protein S8 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223174  Cd Length: 132  Bit Score: 193.52  E-value: 6.24e-64
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H        1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGpdprpeqVI 80
Cdd:COG0096   2 MMTDPLADMLTRIRNAERAKKEVVSMPASKLKGAILKVLKKEGYIKDFEVIDDGRKGKLRVQLKYRINGCG-------VI 74
                        90       100       110       120       130
                ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H       81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:COG0096  75 SPIKRVSKPGLRVYEKKRELPAVLNGLGIAIVSTSKGVMTDKEARKKGVGGEVLCYVW 132
rps8 CHL00042
ribosomal protein S8
1-138 3.20e-55

ribosomal protein S8


Pssm-ID: 214344  Cd Length: 132  Bit Score: 171.51  E-value: 3.20e-55
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         1 MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYERVDVDGKPYLRVYLKYGPRRQGPdprpeqVI 80
Cdd:CHL00042   1 MGNDTIADMLTRIRNANMVKKGTVRIPATNITENIVKILLREGFIENVREHRENNKYFLVLTLKYRGNKKKP------YI 74
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*...
2XG1_H        81 HHIRRISKPGRRVYVGVKEIPRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW 138
Cdd:CHL00042  75 TTLKRISKPGLRIYSNYKEIPRVLGGMGIVILSTSKGIMTDREARLKGIGGEILCYIW 132
rps8p PRK04034
30S ribosomal protein S8P; Reviewed
1-134 7.29e-20

30S ribosomal protein S8P; Reviewed


Pssm-ID: 179721  Cd Length: 130  Bit Score: 79.89  E-value: 7.29e-20
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         1 MLTDPIADMLTRIRNATRVYKESTDV-PASRFKEEILRILAREGFIKGYERVDvDGKpylrvYLKYgprrqgpdprpeqV 79
Cdd:PRK04034   2 VLLDPLANALSTIKNAEMVGKKEVIIkPASKLIGNVLRVMQDEGYIGEFEYID-DGR-----AGKF-------------K 62
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|....
2XG1_H        80 IHHIRRISKPGR---RVYVGVKEIPR-VRRGL-----GIAILSTSKGVLTDREARKLGVGGELI 134
Cdd:PRK04034  63 VELLGRINKCGAikpRYPVKYDEFEKwEKRYLpardfGILIVSTSKGVMSHKEAREKGIGGVLL 126
PLN00146 PLN00146
40S ribosomal protein S15a; Provisional
6-134 1.64e-05

40S ribosomal protein S15a; Provisional


Pssm-ID: 215075  Cd Length: 130  Bit Score: 40.37  E-value: 1.64e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         6 IADMLTRIRNATRVYKESTDV-PASRFKEEILRILAREGFIKGYERVDvdgkpylrvylkygPRRQGpdprpEQVIHHIR 84
Cdd:PLN00146   7 LNDALKTMYNAEKRGKRQVLIrPSSKVVIKFLKVMQKHGYIGEFEVVD--------------DHRSG-----KIVVELNG 67
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
2XG1_H        85 RISKPG---RRVYVGVKEIPRVRRGL------GIAILSTSKGVLTDREARKLGVGGELI 134
Cdd:PLN00146  68 RLNKCGvisPRFDVKVKEIEAWTARLlpsrqfGYIVLTTSAGIMDHEEARRKNVGGKVL 126
PTZ00158 PTZ00158
40S ribosomal protein S15A; Provisional
6-134 4.03e-05

40S ribosomal protein S15A; Provisional


Pssm-ID: 185487  Cd Length: 130  Bit Score: 39.32  E-value: 4.03e-05
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG1_H         6 IADMLTRIRNATRVYKESTDV-PASRFKEEILRILAREGFIKGYERVDvdgkpylrvylkygPRRQGpdprpEQVIHHIR 84
Cdd:PTZ00158   7 LADCLRSIVNAEKQGKRQVLIrPSSKVVVKFLQVMQKHGYIGEFEIVD--------------DHRSG-----KIVVNLNG 67
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*....
2XG1_H        85 RISKPG---RRVYVGVKEIPRV------RRGLGIAILSTSKGVLTDREARKLGVGGELI 134
Cdd:PTZ00158  68 RLNKCGvisPRFDVTLGEFEKWannilpSRQFGHVVLTTSYGIMDHEEARRRHTGGKIL 126
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.15
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A et al. (2009), "CDD: specific functional annotation with the Conserved Domain Database.", Nucleic Acids Res.37(D)205-10.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH