NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568011|pdb|2XG0|R]
View 

Protein Classification

50S ribosomal protein L17 (domain architecture ID 10012472)

50S ribosomal protein L17 is part of the 50S ribosomal subunit and makes contacts with ribosomal protein L32

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplQ PRK05591
50S ribosomal protein L17; Validated
5-117 9.06e-59

50S ribosomal protein L17; Validated


:

Pssm-ID: 235522  Cd Length: 113  Bit Score: 179.90  E-value: 9.06e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         5 KSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIA 84
Cdd:PRK05591   2 KKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLHARRQAFARLRDKEAVHKLFDEIA 81
                         90       100       110
                 ....*....|....*....|....*....|...
2XG0_R        85 PRYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:PRK05591  82 PRYADRNGGYTRILKL-GFRRGDNAPMAIIELV 113
 
Name Accession Description Interval E-value
rplQ PRK05591
50S ribosomal protein L17; Validated
5-117 9.06e-59

50S ribosomal protein L17; Validated


Pssm-ID: 235522  Cd Length: 113  Bit Score: 179.90  E-value: 9.06e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         5 KSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIA 84
Cdd:PRK05591   2 KKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLHARRQAFARLRDKEAVHKLFDEIA 81
                         90       100       110
                 ....*....|....*....|....*....|...
2XG0_R        85 PRYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:PRK05591  82 PRYADRNGGYTRILKL-GFRRGDNAPMAIIELV 113
RplQ COG0203
Ribosomal protein L17 [Translation, ribosomal structure and biogenesis];
1-117 1.26e-53

Ribosomal protein L17 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223281  Cd Length: 116  Bit Score: 166.97  E-value: 1.26e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R        1 MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLF 80
Cdd:COG0203   1 MRHRKKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLANRRLAFARLRDKDAVKKLF 80
                        90       100       110
                ....*....|....*....|....*....|....*..
2XG0_R       81 DEIAPRYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:COG0203  81 DEIAPRYAERNGGYTRILKL-GFRRGDNAPMAIIELV 116
Ribosomal_L17 pfam01196
Ribosomal protein L17;
20-117 9.34e-50

Ribosomal protein L17;


Pssm-ID: 307378  Cd Length: 97  Bit Score: 156.36  E-value: 9.34e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         20 LYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLK 99
Cdd:pfam01196   1 LLRNLVTSLIRHERIETTLAKAKELRRYAEKLITLAKKGDLHARRQAAAYLRDKEAVKKLFDELAPRYADRNGGYTRILK 80
                          90
                  ....*....|....*...
2XG0_R        100 LaERRRGDGAPLALVELV 117
Cdd:pfam01196  81 L-GPRRGDAAPMAIIELV 97
L17 TIGR00059
ribosomal protein L17; Eubacterial and mitochondrial. The mitochondrial form, from yeast, ...
6-117 4.68e-40

ribosomal protein L17; Eubacterial and mitochondrial. The mitochondrial form, from yeast, contains an additional 110 amino acids C-terminal to the region found by this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272880  Cd Length: 111  Bit Score: 132.17  E-value: 4.68e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R          6 SGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAP 85
Cdd:TIGR00059   1 SYRKLGRTSAHRKALLRNLASALIRHEKIETTLAKAKELRRVVEKLITLAKVDNFNNRREAKAYIQNKEIVHKLFSEIAP 80
                          90       100       110
                  ....*....|....*....|....*....|..
2XG0_R         86 RYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:TIGR00059  81 RYAQRPGGYTRILKL-GPRRGDAAPMAIIELV 111
 
Name Accession Description Interval E-value
rplQ PRK05591
50S ribosomal protein L17; Validated
5-117 9.06e-59

50S ribosomal protein L17; Validated


Pssm-ID: 235522  Cd Length: 113  Bit Score: 179.90  E-value: 9.06e-59
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         5 KSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIA 84
Cdd:PRK05591   2 KKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLHARRQAFARLRDKEAVHKLFDEIA 81
                         90       100       110
                 ....*....|....*....|....*....|...
2XG0_R        85 PRYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:PRK05591  82 PRYADRNGGYTRILKL-GFRRGDNAPMAIIELV 113
RplQ COG0203
Ribosomal protein L17 [Translation, ribosomal structure and biogenesis];
1-117 1.26e-53

Ribosomal protein L17 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223281  Cd Length: 116  Bit Score: 166.97  E-value: 1.26e-53
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R        1 MRHLKSGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLF 80
Cdd:COG0203   1 MRHRKKGRKLGRTSSHRKAMLRNLATSLIEHERIETTLPKAKELRRVVEKLITLAKKGDLANRRLAFARLRDKDAVKKLF 80
                        90       100       110
                ....*....|....*....|....*....|....*..
2XG0_R       81 DEIAPRYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:COG0203  81 DEIAPRYAERNGGYTRILKL-GFRRGDNAPMAIIELV 116
Ribosomal_L17 pfam01196
Ribosomal protein L17;
20-117 9.34e-50

Ribosomal protein L17;


Pssm-ID: 307378  Cd Length: 97  Bit Score: 156.36  E-value: 9.34e-50
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         20 LYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRYRDRQGGYTRVLK 99
Cdd:pfam01196   1 LLRNLVTSLIRHERIETTLAKAKELRRYAEKLITLAKKGDLHARRQAAAYLRDKEAVKKLFDELAPRYADRNGGYTRILK 80
                          90
                  ....*....|....*...
2XG0_R        100 LaERRRGDGAPLALVELV 117
Cdd:pfam01196  81 L-GPRRGDAAPMAIIELV 97
L17 TIGR00059
ribosomal protein L17; Eubacterial and mitochondrial. The mitochondrial form, from yeast, ...
6-117 4.68e-40

ribosomal protein L17; Eubacterial and mitochondrial. The mitochondrial form, from yeast, contains an additional 110 amino acids C-terminal to the region found by this model. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272880  Cd Length: 111  Bit Score: 132.17  E-value: 4.68e-40
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R          6 SGRKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAP 85
Cdd:TIGR00059   1 SYRKLGRTSAHRKALLRNLASALIRHEKIETTLAKAKELRRVVEKLITLAKVDNFNNRREAKAYIQNKEIVHKLFSEIAP 80
                          90       100       110
                  ....*....|....*....|....*....|..
2XG0_R         86 RYRDRQGGYTRVLKLaERRRGDGAPLALVELV 117
Cdd:TIGR00059  81 RYAQRPGGYTRILKL-GPRRGDAAPMAIIELV 111
PTZ00076 PTZ00076
60S ribosomal protein L17; Provisional
8-118 4.53e-19

60S ribosomal protein L17; Provisional


Pssm-ID: 173371  Cd Length: 253  Bit Score: 80.23  E-value: 4.53e-19
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_R         8 RKLNRHSSHRLALYRNQAKSLLTHGRITTTVPKAKELRGFVDHLIHLAKRGDLHARRLVLRDLQDVKLVRKLFDEIAPRY 87
Cdd:PTZ00076  20 RRAHGQPHHRWDSIKNQLDELLRYGRLELTLPRAKELQQYAEELIYLAKKDTPESNLKVESMLRTPQGRRKLYEKYVPLY 99
                         90       100       110
                 ....*....|....*....|....*....|.
2XG0_R        88 RDRQGGYTRVLKLAERRRGDGAPLALVELVE 118
Cdd:PTZ00076 100 RDRPFFFTRVVNQWRLRLRDAAPMAYIEFVD 130
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH