NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307568010|pdb|2XG0|Q]
View 

Protein Classification

similar to 60S ribosomal protein L16, mitochondrial (domain architecture ID 10793163)

protein similar to 60S ribosomal protein L16, mitochondrial

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rplP PRK09203
50S ribosomal protein L16; Reviewed
1-135 4.69e-91

50S ribosomal protein L16; Reviewed


:

Pssm-ID: 236411  Cd Length: 138  Bit Score: 263.88  E-value: 4.69e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q         1 MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLE 80
Cdd:PRK09203   1 MLQPKRTKYRKQHKGRNRGKAKRGNTVAFGEFGLKALEPGWITARQIEAARIAMTRHIKRGGKVWIRIFPDKPVTKKPAE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG0_Q        81 VRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRD 135
Cdd:PRK09203  81 VRMGKGKGSPEYWVAVVKPGRILFEIAGVSEELAREALRLAAAKLPIKTKFVKRG 135
 
Name Accession Description Interval E-value
rplP PRK09203
50S ribosomal protein L16; Reviewed
1-135 4.69e-91

50S ribosomal protein L16; Reviewed


Pssm-ID: 236411  Cd Length: 138  Bit Score: 263.88  E-value: 4.69e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q         1 MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLE 80
Cdd:PRK09203   1 MLQPKRTKYRKQHKGRNRGKAKRGNTVAFGEFGLKALEPGWITARQIEAARIAMTRHIKRGGKVWIRIFPDKPVTKKPAE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG0_Q        81 VRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRD 135
Cdd:PRK09203  81 VRMGKGKGSPEYWVAVVKPGRILFEIAGVSEELAREALRLAAAKLPIKTKFVKRG 135
rplP_bact TIGR01164
ribosomal protein L16, bacterial/organelle; This model describes bacterial and organellar ...
3-127 8.30e-73

ribosomal protein L16, bacterial/organelle; This model describes bacterial and organellar ribosomal protein L16. The homologous protein of the eukaryotic cytosol is designated L10 [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273476  Cd Length: 125  Bit Score: 217.24  E-value: 8.30e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q          3 MPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVR 82
Cdd:TIGR01164   1 SPKRTKYRKQQRGRVKGKAKRGNTVAFGEYGLQALEPGWITARQIEAARVAMTRYVKRGGKLWIRIFPDKPYTKKPLETR 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
2XG0_Q         83 MGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPI 127
Cdd:TIGR01164  81 MGKGKGNPEYWVAVVKPGKILFEIAGVPEEVAREAFRLAASKLPI 125
RplP COG0197
Ribosomal protein L16/L10AE [Translation, ribosomal structure and biogenesis];
1-139 3.03e-66

Ribosomal protein L16/L10AE [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223275  Cd Length: 146  Bit Score: 201.27  E-value: 3.03e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q        1 MLMPRRMKYRKQQRGRLKGAT--KGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKP 78
Cdd:COG0197   2 MLQPKRTKYRKQHKGRGPGITiaKGGNKVFFGEYGLVALEPGQITARQIEAARIAANRYLKRGGGLWIRVFPDKPLTEKP 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_Q       79 LEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDE 139
Cdd:COG0197  82 GEDRMGKGKGKPEGWAARVKPGRVLFEIAGVPEELAREALRRAAAKLPVKTKFVIRIEKRE 142
Ribosomal_L16 pfam00252
Ribosomal protein L16p/L10e;
4-125 1.79e-56

Ribosomal protein L16p/L10e;


Pssm-ID: 306711  Cd Length: 125  Bit Score: 175.33  E-value: 1.79e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q          4 PRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFR--RGGKIFIRIFPDKPYTKKPLEV 81
Cdd:pfam00252   1 PKRTKYRKSRKRYIRGVPTKGTTLDFGDYGLVALEGGQITARQLEAARIAINRYLKktRGGKLWIRVFPDKPVTKKAGED 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
2XG0_Q         82 RMGKGKGNVEGYVAVVKPGRVMFEV-AGVTEEQAMEALRIAGHKL 125
Cdd:pfam00252  81 RMGKGKGKPEGWVARVKPGRILFEIrGGVHEEVAKEALRLAAHKL 125
Ribosomal_L16_L10e cd01433
Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, ...
24-132 1.46e-50

Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with the 30S subunit, binding of aminoacyl-tRNA and interaction with antibiotics. L16 is required for the function of elongation factor P (EF-P), a protein involved in peptide bond synthesis through the stimulation of peptidyl transferase activity by the ribosome. Mutations in L16 and the adjoining bases of 23S rRNA confer antibiotic resistance in bacteria, suggesting a role for L16 in the formation of the antibiotic binding site. The GTPase RbgA (YlqF) is essential for the assembly of the large subunit, and it is believed to regulate the incorporation of L16. L10e is the archaeal and eukaryotic cytosolic homolog of bacterial L16. L16 and L10e exhibit structural differences at the N-terminus.


Pssm-ID: 238714  Cd Length: 112  Bit Score: 159.96  E-value: 1.46e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q       24 GDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRR-GGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRV 102
Cdd:cd01433   2 GNKLFFGEYGLVALEPGRITAEQLEAARIAINRYLKKkGGKLWIRVFPDHPVTKKPLETRMGKGKGKPEGWVARVKPGQI 81
                        90       100       110
                ....*....|....*....|....*....|.
2XG0_Q      103 MFEVAGV-TEEQAMEALRIAGHKLPIKTKIV 132
Cdd:cd01433  82 LFEVRGVpEEEVAKEALRRAAKKLPIKTKIV 112
 
Name Accession Description Interval E-value
rplP PRK09203
50S ribosomal protein L16; Reviewed
1-135 4.69e-91

50S ribosomal protein L16; Reviewed


Pssm-ID: 236411  Cd Length: 138  Bit Score: 263.88  E-value: 4.69e-91
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q         1 MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLE 80
Cdd:PRK09203   1 MLQPKRTKYRKQHKGRNRGKAKRGNTVAFGEFGLKALEPGWITARQIEAARIAMTRHIKRGGKVWIRIFPDKPVTKKPAE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG0_Q        81 VRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRD 135
Cdd:PRK09203  81 VRMGKGKGSPEYWVAVVKPGRILFEIAGVSEELAREALRLAAAKLPIKTKFVKRG 135
rplP_bact TIGR01164
ribosomal protein L16, bacterial/organelle; This model describes bacterial and organellar ...
3-127 8.30e-73

ribosomal protein L16, bacterial/organelle; This model describes bacterial and organellar ribosomal protein L16. The homologous protein of the eukaryotic cytosol is designated L10 [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 273476  Cd Length: 125  Bit Score: 217.24  E-value: 8.30e-73
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q          3 MPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLEVR 82
Cdd:TIGR01164   1 SPKRTKYRKQQRGRVKGKAKRGNTVAFGEYGLQALEPGWITARQIEAARVAMTRYVKRGGKLWIRIFPDKPYTKKPLETR 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
2XG0_Q         83 MGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPI 127
Cdd:TIGR01164  81 MGKGKGNPEYWVAVVKPGKILFEIAGVPEEVAREAFRLAASKLPI 125
rpl16 CHL00044
ribosomal protein L16
1-135 3.25e-68

ribosomal protein L16


Pssm-ID: 176985  Cd Length: 135  Bit Score: 205.90  E-value: 3.25e-68
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q         1 MLMPRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKPLE 80
Cdd:CHL00044   1 MLSPKRTKFRKQHRGRMKGISYRGNRICFGRYALQALEPAWITSRQIEAGRRAITRYARRGGKIWIRIFPDKPVTMRPAE 80
                         90       100       110       120       130
                 ....*....|....*....|....*....|....*....|....*....|....*
2XG0_Q        81 VRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRD 135
Cdd:CHL00044  81 TRMGSGKGSPEYWVAVVKPGRILYEMGGVSETIARAAIKIAAYKMPIKTQFIISE 135
RplP COG0197
Ribosomal protein L16/L10AE [Translation, ribosomal structure and biogenesis];
1-139 3.03e-66

Ribosomal protein L16/L10AE [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223275  Cd Length: 146  Bit Score: 201.27  E-value: 3.03e-66
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q        1 MLMPRRMKYRKQQRGRLKGAT--KGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRRGGKIFIRIFPDKPYTKKP 78
Cdd:COG0197   2 MLQPKRTKYRKQHKGRGPGITiaKGGNKVFFGEYGLVALEPGQITARQIEAARIAANRYLKRGGGLWIRVFPDKPLTEKP 81
                        90       100       110       120       130       140
                ....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_Q       79 LEVRMGKGKGNVEGYVAVVKPGRVMFEVAGVTEEQAMEALRIAGHKLPIKTKIVRRDAYDE 139
Cdd:COG0197  82 GEDRMGKGKGKPEGWAARVKPGRVLFEIAGVPEELAREALRRAAAKLPVKTKFVIRIEKRE 142
Ribosomal_L16 pfam00252
Ribosomal protein L16p/L10e;
4-125 1.79e-56

Ribosomal protein L16p/L10e;


Pssm-ID: 306711  Cd Length: 125  Bit Score: 175.33  E-value: 1.79e-56
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q          4 PRRMKYRKQQRGRLKGATKGGDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFR--RGGKIFIRIFPDKPYTKKPLEV 81
Cdd:pfam00252   1 PKRTKYRKSRKRYIRGVPTKGTTLDFGDYGLVALEGGQITARQLEAARIAINRYLKktRGGKLWIRVFPDKPVTKKAGED 80
                          90       100       110       120
                  ....*....|....*....|....*....|....*....|....*
2XG0_Q         82 RMGKGKGNVEGYVAVVKPGRVMFEV-AGVTEEQAMEALRIAGHKL 125
Cdd:pfam00252  81 RMGKGKGKPEGWVARVKPGRILFEIrGGVHEEVAKEALRLAAHKL 125
Ribosomal_L16_L10e cd01433
Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, ...
24-132 1.46e-50

Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with the 30S subunit, binding of aminoacyl-tRNA and interaction with antibiotics. L16 is required for the function of elongation factor P (EF-P), a protein involved in peptide bond synthesis through the stimulation of peptidyl transferase activity by the ribosome. Mutations in L16 and the adjoining bases of 23S rRNA confer antibiotic resistance in bacteria, suggesting a role for L16 in the formation of the antibiotic binding site. The GTPase RbgA (YlqF) is essential for the assembly of the large subunit, and it is believed to regulate the incorporation of L16. L10e is the archaeal and eukaryotic cytosolic homolog of bacterial L16. L16 and L10e exhibit structural differences at the N-terminus.


Pssm-ID: 238714  Cd Length: 112  Bit Score: 159.96  E-value: 1.46e-50
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q       24 GDYVAFGDYGLVALEPAWITAQQIEAARVAMVRHFRR-GGKIFIRIFPDKPYTKKPLEVRMGKGKGNVEGYVAVVKPGRV 102
Cdd:cd01433   2 GNKLFFGEYGLVALEPGRITAEQLEAARIAINRYLKKkGGKLWIRVFPDHPVTKKPLETRMGKGKGKPEGWVARVKPGQI 81
                        90       100       110
                ....*....|....*....|....*....|.
2XG0_Q      103 MFEVAGV-TEEQAMEALRIAGHKLPIKTKIV 132
Cdd:cd01433  82 LFEVRGVpEEEVAKEALRRAAKKLPIKTKIV 112
rpl10e PRK04199
50S ribosomal protein L10e; Reviewed
34-132 1.73e-06

50S ribosomal protein L10e; Reviewed


Pssm-ID: 235252  Cd Length: 172  Bit Score: 44.45  E-value: 1.73e-06
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q        34 LVALEPAWITAQQIEAARVAMVRHFRR-----GGKIFIRIFPDKPYTKKPLEV-----RMGKGK----GNVEGYVAVVKP 99
Cdd:PRK04199  49 LVVEEPCQIRHNALEAARIAANKYLTKtvgrsNYHLKIRVYPHHVLRENKMATgagadRVSDGMrlafGKPVGTAARVEK 128
                         90       100       110
                 ....*....|....*....|....*....|....*
2XG0_Q       100 GRVMFEVAGVTE--EQAMEALRIAGHKLPIKTKIV 132
Cdd:PRK04199 129 GQKIFTVRVNPEhlEAAKEALRRAAMKLPTPCRIV 163
uL16_euk_arch TIGR00279
ribosomal protein uL16(L10.e), eukarotic/archaeal form; This model finds the archaeal and ...
34-132 5.69e-06

ribosomal protein uL16(L10.e), eukarotic/archaeal form; This model finds the archaeal and eukaryotic forms of ribosomal protein uL16, previously L10.e. The protein is encoded by multiple loci in some eukaryotes and has been assigned a number of extra-ribosomal functions, some of which will require re-evaluation in the context of identification as a ribosomal protein. L10.e is distantly related to eubacterial ribosomal protein L16. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 129380  Cd Length: 172  Bit Score: 43.31  E-value: 5.69e-06
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_Q         34 LVALEPAWITAQQIEAARVAMVRHF-----RRGGKIFIRIFPDKPYTKKPLEVRMGKGK---------GNVEGYVAVVKP 99
Cdd:TIGR00279  49 LVAKEPEQIRHNALEAARIAANKYMtrragRMGYHLKIRVYPHHILRENKMATGAGADRiqqgmrgafGKPVGTAARVKI 128
                          90       100       110
                  ....*....|....*....|....*....|....*
2XG0_Q        100 GRVMFEVAGVTE--EQAMEALRIAGHKLPIKTKIV 132
Cdd:TIGR00279 129 GQKIFSVWTKPSnfDVAKEALRRAAMKFPVPCKIV 163
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH