NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307567991|pdb|2XG0|4]
View 

Protein Classification

50S ribosomal protein L31 (domain architecture ID 10011073)

50S ribosomal protein L31 binds the 23S rRNA in a Zn(II)-dependent manner

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rpmE PRK00019
50S ribosomal protein L31; Reviewed
1-69 1.60e-37

50S ribosomal protein L31; Reviewed


:

Pssm-ID: 234576  Cd Length: 72  Bit Score: 122.34  E-value: 1.60e-37
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_4        1 MKEGIHPKLVPARIICGCGNVIETYST--KPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRK 69
Cdd:PRK00019  1 MKKDIHPKYEEVTVTCSCGNVFETRSTlgKDEINVDVCSKCHPFYTGKQKIVDTGGRVERFNKRFGKKGKK 71
 
Name Accession Description Interval E-value
rpmE PRK00019
50S ribosomal protein L31; Reviewed
1-69 1.60e-37

50S ribosomal protein L31; Reviewed


Pssm-ID: 234576  Cd Length: 72  Bit Score: 122.34  E-value: 1.60e-37
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_4        1 MKEGIHPKLVPARIICGCGNVIETYST--KPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRK 69
Cdd:PRK00019  1 MKKDIHPKYEEVTVTCSCGNVFETRSTlgKDEINVDVCSKCHPFYTGKQKIVDTGGRVERFNKRFGKKGKK 71
Ribosomal_L31 pfam01197
Ribosomal protein L31;
1-64 1.35e-36

Ribosomal protein L31;


Pssm-ID: 307379  Cd Length: 65  Bit Score: 119.81  E-value: 1.35e-36
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG0_4         1 MKEGIHPKLVPARIICGCGNVIETYST-KPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64
Cdd:pfam01197  1 MKKGIHPEYHEVTVTCTCGNTFLTRSTaYPEIKVDVCSACHPFYTGKQKLVDTAGRVEKFNKRYG 65
RpmE COG0254
Ribosomal protein L31 [Translation, ribosomal structure and biogenesis];
1-71 2.37e-30

Ribosomal protein L31 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223332  Cd Length: 75  Bit Score: 104.32  E-value: 2.37e-30
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG0_4       1 MKEGIHPKLV-PARIICG-CGNVIETYSTKP--EIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR 71
Cdd:COG0254  1 MKKDIHPEYYrPVVFVCSsCGNEFTTRSTKGtdEINLDVCSKCHPFYTGKQKIVDTEGRVEKFNKRFGGFKGKKK 75
L31 TIGR00105
ribosomal protein L31; This family consists exclusively of bacterial (and organellar) 50S ...
1-64 4.50e-27

ribosomal protein L31; This family consists exclusively of bacterial (and organellar) 50S ribosomal protein L31. In some species, such as Bacillus subtilis, this protein exists in two forms (RpmE and YtiA), one of which (RpmE) contains a pair of motifs, CXC and CXXC, for binding zinc. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272907  Cd Length: 68  Bit Score: 95.43  E-value: 4.50e-27
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG0_4         1 MKEGIHPKLVPARIICGCGNVIETYSTKPE--IYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64
Cdd:TIGR00105  1 MKKDIHPDYHEITVTCTCGNVFTTRSTWGKetLNLDICSKCHPFYTGKQKIVDTGGRVDKFNKKFG 66
 
Name Accession Description Interval E-value
rpmE PRK00019
50S ribosomal protein L31; Reviewed
1-69 1.60e-37

50S ribosomal protein L31; Reviewed


Pssm-ID: 234576  Cd Length: 72  Bit Score: 122.34  E-value: 1.60e-37
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_4        1 MKEGIHPKLVPARIICGCGNVIETYST--KPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRK 69
Cdd:PRK00019  1 MKKDIHPKYEEVTVTCSCGNVFETRSTlgKDEINVDVCSKCHPFYTGKQKIVDTGGRVERFNKRFGKKGKK 71
Ribosomal_L31 pfam01197
Ribosomal protein L31;
1-64 1.35e-36

Ribosomal protein L31;


Pssm-ID: 307379  Cd Length: 65  Bit Score: 119.81  E-value: 1.35e-36
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG0_4         1 MKEGIHPKLVPARIICGCGNVIETYST-KPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64
Cdd:pfam01197  1 MKKGIHPEYHEVTVTCTCGNTFLTRSTaYPEIKVDVCSACHPFYTGKQKLVDTAGRVEKFNKRYG 65
RpmE COG0254
Ribosomal protein L31 [Translation, ribosomal structure and biogenesis];
1-71 2.37e-30

Ribosomal protein L31 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223332  Cd Length: 75  Bit Score: 104.32  E-value: 2.37e-30
                       10        20        30        40        50        60        70
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG0_4       1 MKEGIHPKLV-PARIICG-CGNVIETYSTKP--EIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYGDSYRKGR 71
Cdd:COG0254  1 MKKDIHPEYYrPVVFVCSsCGNEFTTRSTKGtdEINLDVCSKCHPFYTGKQKIVDTEGRVEKFNKRFGGFKGKKK 75
L31 TIGR00105
ribosomal protein L31; This family consists exclusively of bacterial (and organellar) 50S ...
1-64 4.50e-27

ribosomal protein L31; This family consists exclusively of bacterial (and organellar) 50S ribosomal protein L31. In some species, such as Bacillus subtilis, this protein exists in two forms (RpmE and YtiA), one of which (RpmE) contains a pair of motifs, CXC and CXXC, for binding zinc. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 272907  Cd Length: 68  Bit Score: 95.43  E-value: 4.50e-27
                         10        20        30        40        50        60
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*.
2XG0_4         1 MKEGIHPKLVPARIICGCGNVIETYSTKPE--IYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64
Cdd:TIGR00105  1 MKKDIHPDYHEITVTCTCGNVFTTRSTWGKetLNLDICSKCHPFYTGKQKIVDTGGRVDKFNKKFG 66
rpmE PRK00528
50S ribosomal protein L31; Reviewed
1-66 2.05e-23

50S ribosomal protein L31; Reviewed


Pssm-ID: 179057  Cd Length: 71  Bit Score: 86.16  E-value: 2.05e-23
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XG0_4        1 MKEGIHPKLVPARIICGCGNVIET----YSTKPEIYVEVCSKCHPFYT-GQQRFVDTEGRVERFQRRYGDS 66
Cdd:PRK00528  1 MKKDIHPDYHPIKVVMTDGTEYETrstwGKTGPELRLDIDSGNHPAWTgGTQKLLDTGGRVAKFNKKFGGL 71
rpl31 CHL00136
ribosomal protein L31; Validated
1-64 2.12e-20

ribosomal protein L31; Validated


Pssm-ID: 177058  Cd Length: 68  Bit Score: 78.54  E-value: 2.12e-20
                        10        20        30        40        50        60
                ....*....|....*....|....*....|....*....|....*....|....*....|....*
2XG0_4        1 MKEGIHPKLVP-ARIICGCGNVIETYSTKPEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQRRYG 64
Cdd:CHL00136  2 PKKNIHPQWFPeTKVYCDGQLVMTVGSTKPELNVDIWSGNHPFYTGSQKIIDTEGRVERFMKKYG 66
rpmE2 PRK01678
50S ribosomal protein L31 type B; Reviewed
1-64 1.71e-19

50S ribosomal protein L31 type B; Reviewed


Pssm-ID: 234969  Cd Length: 87  Bit Score: 76.46  E-value: 1.71e-19
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XG0_4        1 MKEGIHPKLVP---------ARIICGcgnviETYSTK-----------PEIYVEVCSKCHPFYTGQQRFVDTEGRVERFQ 60
Cdd:PRK01678  1 MKKGIHPEYRPvvfhdtstgFKFLTG-----STITTDetiewedgktyPLVKVEISSASHPFYTGKQKFVDTEGRVEKFN 75

                ....
2XG0_4       61 RRYG 64
Cdd:PRK01678 76 KRFG 79
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH