NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|307567978|pdb|2XFZ|Q]
View 

Protein Classification

30S ribosomal protein S17 (domain architecture ID 10012501)

30S ribosomal protein S17 is one of the primary rRNA binding proteins; it binds specifically to the 5'-end of 16S ribosomal RNA and plays a role in translational accuracy

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
rpsQ PRK05610
30S ribosomal protein S17; Reviewed
1-81 3.69e-39

30S ribosomal protein S17; Reviewed


:

Pssm-ID: 235532  Cd Length: 84  Bit Score: 128.35  E-value: 3.69e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q         1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:PRK05610   4 MPRKTLQGRVVSDKMDKTIVVLVERRVKHPLYGKIVKRSKKYHAHDENNEAKIGDVVRIMETRPLSKTKRWRLVEIVEKA 83

                 .
2XFZ_Q        81 R 81
Cdd:PRK05610  84 V 84
 
Name Accession Description Interval E-value
rpsQ PRK05610
30S ribosomal protein S17; Reviewed
1-81 3.69e-39

30S ribosomal protein S17; Reviewed


Pssm-ID: 235532  Cd Length: 84  Bit Score: 128.35  E-value: 3.69e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q         1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:PRK05610   4 MPRKTLQGRVVSDKMDKTIVVLVERRVKHPLYGKIVKRSKKYHAHDENNEAKIGDVVRIMETRPLSKTKRWRLVEIVEKA 83

                 .
2XFZ_Q        81 R 81
Cdd:PRK05610  84 V 84
uS17_bact TIGR03635
ribosomal protein uS17, bacterial form; This model describes the bacterial ribosomal small ...
3-73 3.58e-35

ribosomal protein uS17, bacterial form; This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274691  Cd Length: 72  Bit Score: 118.03  E-value: 3.58e-35
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XFZ_Q          3 KKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRV 73
Cdd:TIGR03635   1 RKTLQGVVVSDKMDKTVVVLVERRVKHPLYKKIVKRTKKYHAHDENNECKVGDVVRIIETRPLSKTKRWRL 71
Ribosomal_S17 pfam00366
Ribosomal protein S17;
8-75 2.57e-33

Ribosomal protein S17;


Pssm-ID: 306800  Cd Length: 68  Bit Score: 112.87  E-value: 2.57e-33
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2XFZ_Q          8 GVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLR 75
Cdd:pfam00366   1 GVVVSDKMDKTVVVRVERLVKHPKYKKYVKRTKKYHAHDENNECKVGDIVRIAECRPLSKTKRWVVVE 68
RpsQ COG0186
Ribosomal protein S17 [Translation, ribosomal structure and biogenesis];
1-81 9.19e-32

Ribosomal protein S17 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223264  Cd Length: 87  Bit Score: 109.61  E-value: 9.19e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q        1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:COG0186   6 VRGRVLEGVVVSDKMDKTVVVEVERKVYHPKYGKYVRRSKKYHAHDECNEAKVGDIVRIAETRPLSKTKRFVVVEIVEKA 85

                .
2XFZ_Q       81 R 81
Cdd:COG0186  86 V 86
 
Name Accession Description Interval E-value
rpsQ PRK05610
30S ribosomal protein S17; Reviewed
1-81 3.69e-39

30S ribosomal protein S17; Reviewed


Pssm-ID: 235532  Cd Length: 84  Bit Score: 128.35  E-value: 3.69e-39
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q         1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:PRK05610   4 MPRKTLQGRVVSDKMDKTIVVLVERRVKHPLYGKIVKRSKKYHAHDENNEAKIGDVVRIMETRPLSKTKRWRLVEIVEKA 83

                 .
2XFZ_Q        81 R 81
Cdd:PRK05610  84 V 84
uS17_bact TIGR03635
ribosomal protein uS17, bacterial form; This model describes the bacterial ribosomal small ...
3-73 3.58e-35

ribosomal protein uS17, bacterial form; This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274691  Cd Length: 72  Bit Score: 118.03  E-value: 3.58e-35
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|.
2XFZ_Q          3 KKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRV 73
Cdd:TIGR03635   1 RKTLQGVVVSDKMDKTVVVLVERRVKHPLYKKIVKRTKKYHAHDENNECKVGDVVRIIETRPLSKTKRWRL 71
Ribosomal_S17 pfam00366
Ribosomal protein S17;
8-75 2.57e-33

Ribosomal protein S17;


Pssm-ID: 306800  Cd Length: 68  Bit Score: 112.87  E-value: 2.57e-33
                          10        20        30        40        50        60
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*...
2XFZ_Q          8 GVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLR 75
Cdd:pfam00366   1 GVVVSDKMDKTVVVRVERLVKHPKYKKYVKRTKKYHAHDENNECKVGDIVRIAECRPLSKTKRWVVVE 68
RpsQ COG0186
Ribosomal protein S17 [Translation, ribosomal structure and biogenesis];
1-81 9.19e-32

Ribosomal protein S17 [Translation, ribosomal structure and biogenesis];


Pssm-ID: 223264  Cd Length: 87  Bit Score: 109.61  E-value: 9.19e-32
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q        1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:COG0186   6 VRGRVLEGVVVSDKMDKTVVVEVERKVYHPKYGKYVRRSKKYHAHDECNEAKVGDIVRIAETRPLSKTKRFVVVEIVEKA 85

                .
2XFZ_Q       81 R 81
Cdd:COG0186  86 V 86
rps17 CHL00142
ribosomal protein S17; Validated
1-70 1.24e-27

ribosomal protein S17; Validated


Pssm-ID: 177064  Cd Length: 84  Bit Score: 98.96  E-value: 1.24e-27
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q         1 MPKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKR 70
Cdd:CHL00142   1 MPVKEKIGIVVSNKMNKTIVVAVENRYKHPIYGKIITKTKKYLVHDEENECNIGDQVLIEETRPLSKTKR 70
rps17p PRK08572
30S ribosomal protein S17P; Reviewed
4-78 9.34e-14

30S ribosomal protein S17P; Reviewed


Pssm-ID: 236296  Cd Length: 108  Bit Score: 63.01  E-value: 9.34e-14
                         10        20        30        40        50        60        70
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
2XFZ_Q         4 KVLTGVVVSDKMQKTVTvlVERQFPH--PLYGKVIKRSKKYLAHDPE-EKYKLGDVVEIIESRPISKRKRFRVLRLVE 78
Cdd:PRK08572  30 QVLEGTVVSDKMHKTVV--VEREYLHyvPKYERYEKRRSRIHAHNPPcIDAKVGDKVKIAECRPLSKTKSFVVVEKKE 105
uS17_arch TIGR03630
ribosomal protein uS17, archaeal form; This model describes exclusively the archaeal ribosomal ...
4-74 8.57e-13

ribosomal protein uS17, archaeal form; This model describes exclusively the archaeal ribosomal protein S17P. It excludes the homologous ribosomal protein S17 from bacteria, and is not intended for use on eukaryotic sequences, where some instances of ribosomal proteins S11 score above the trusted cutoff. [Protein synthesis, Ribosomal proteins: synthesis and modification]


Pssm-ID: 274687  Cd Length: 102  Bit Score: 60.39  E-value: 8.57e-13
                          10        20        30        40        50        60        70
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
2XFZ_Q          4 KVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPE-EKYKLGDVVEIIESRPISKRKRFRVL 74
Cdd:TIGR03630  28 QILEGVVVSDKMNKTVVVEREYLYYIRKYERYERRRSKIHAHNPPcIDVKVGDIVIIAETRPLSKTKSFVVL 99
PTZ00241 PTZ00241
40S ribosomal protein S11; Provisional
4-87 6.70e-07

40S ribosomal protein S11; Provisional


Pssm-ID: 240326  Cd Length: 158  Bit Score: 44.69  E-value: 6.70e-07
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2XFZ_Q         4 KVLTGVVVSDKMQKTVtvLVERQFPH--PLYGKVIKRSKKYLAH-DPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESG 80
Cdd:PTZ00241  69 RILRGVVISTKMKRTI--IIRRDYLHyvKKYNRYEKRHKNIPVHcSPCFDVKEGDIVVVGQCRPLSKTVRFNVLKVEKNE 146

                 ....*..
2XFZ_Q        81 RMDLVEK 87
Cdd:PTZ00241 147 IIGNVRK 153
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH