NCBI Home Page NCBI Site Search page NCBI Guide that lists and describes the NCBI resources
Conserved domains on  [gi|12084569|pdb|1G3J|A]
View 

Protein Classification

ARM domain-containing protein (domain architecture ID 11758492)

protein containing domains Arm_3, and ARM

Graphical summary

 Zoom to residue level

show extra options »

Show site features     Horizontal zoom: ×

List of domain hits

Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
218-258 1.58e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


:

Pssm-ID: 214547  Cd Length: 41  Bit Score: 43.57  E-value: 1.58e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
1G3J_A         218 CSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD 258
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm_3 super family cl25709
Atypical Arm repeat; This atypical Arm repeat appears at the very C-terminus of eukaryotic ...
10-299 3.58e-04

Atypical Arm repeat; This atypical Arm repeat appears at the very C-terminus of eukaryotic proteins such as importin subunit alpha-2, as the last of the repeating units.


The actual alignment was detected with superfamily member COG5064:

Pssm-ID: 330530  Cd Length: 526  Bit Score: 42.96  E-value: 3.58e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       10 YQDDAELATRAIPELTKLLNDED----QVVVNKAAVmvhqlskkeasrhaimrsPQMVSAIVRTMQNTNDVETARCTAGT 85
Cdd:COG5064  81 FSDDIEQQLQAVYKFRKLLSKETsppiQPVIDAGVV------------------PRFVEFMDEIQRDMLQFEAAWALTNI 142
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       86 LHNLSHHREgllAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALL--NKTNVKFLA 163
Cdd:COG5064 143 ASGTTQQTK---VVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLlsSAIHISMLR 219
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A      164 ITTDCLQILAYG--------NQESKLIILASggpqaLVNIMRTYTYEKLLWTTSRVLKVLSVCSSnkpAIVEAGGMQALG 235
Cdd:COG5064 220 NATWTLSNLCRGknpppdwsNISQALPILAK-----LIYSRDPEVLVDACWAISYLSDGPNEKIQ---AVLDVGIPGRLV 291
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1G3J_A      236 LHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNN 299
Cdd:COG5064 292 ELLSHESAKIQTPALRSVGNIvtgSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGN 358
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
451-490 5.60e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


:

Pssm-ID: 278915  Cd Length: 41  Bit Score: 38.97  E-value: 5.60e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
1G3J_A        451 DVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELA 490
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLA 40
 
Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
218-258 1.58e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 43.57  E-value: 1.58e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
1G3J_A         218 CSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD 258
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
221-258 2.00e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 40.51  E-value: 2.00e-04
                          10        20        30
                  ....*....|....*....|....*....|....*...
1G3J_A        221 NKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD 258
Cdd:pfam00514   4 NKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLAA 41
SRP1 COG5064
Karyopherin (importin) alpha [Intracellular trafficking and secretion];
10-299 3.58e-04

Karyopherin (importin) alpha [Intracellular trafficking and secretion];


Pssm-ID: 227396  Cd Length: 526  Bit Score: 42.96  E-value: 3.58e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       10 YQDDAELATRAIPELTKLLNDED----QVVVNKAAVmvhqlskkeasrhaimrsPQMVSAIVRTMQNTNDVETARCTAGT 85
Cdd:COG5064  81 FSDDIEQQLQAVYKFRKLLSKETsppiQPVIDAGVV------------------PRFVEFMDEIQRDMLQFEAAWALTNI 142
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       86 LHNLSHHREgllAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALL--NKTNVKFLA 163
Cdd:COG5064 143 ASGTTQQTK---VVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLlsSAIHISMLR 219
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A      164 ITTDCLQILAYG--------NQESKLIILASggpqaLVNIMRTYTYEKLLWTTSRVLKVLSVCSSnkpAIVEAGGMQALG 235
Cdd:COG5064 220 NATWTLSNLCRGknpppdwsNISQALPILAK-----LIYSRDPEVLVDACWAISYLSDGPNEKIQ---AVLDVGIPGRLV 291
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1G3J_A      236 LHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNN 299
Cdd:COG5064 292 ELLSHESAKIQTPALRSVGNIvtgSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGN 358
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
451-490 5.60e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 38.97  E-value: 5.60e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
1G3J_A        451 DVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELA 490
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLA 40
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
98-130 7.76e-04

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 38.56  E-value: 7.76e-04
                           10        20        30
                   ....*....|....*....|....*....|...
1G3J_A          98 AIFKSGGIPALVKMLGSPVDSVLFYAITTLHNL 130
Cdd:smart00185   7 AVVDAGGLPALVELLKSEDEEVVKEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
98-130 4.86e-03

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 36.27  E-value: 4.86e-03
                          10        20        30
                  ....*....|....*....|....*....|...
1G3J_A         98 AIFKSGGIPALVKMLGSPVDSVLFYAITTLHNL 130
Cdd:pfam00514   7 AVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNL 39
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
451-491 4.98e-03

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 36.25  E-value: 4.98e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
1G3J_A         451 DVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQ 491
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
 
Name Accession Description Interval E-value
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
218-258 1.58e-05

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 43.57  E-value: 1.58e-05
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
1G3J_A         218 CSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD 258
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
221-258 2.00e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 40.51  E-value: 2.00e-04
                          10        20        30
                  ....*....|....*....|....*....|....*...
1G3J_A        221 NKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSD 258
Cdd:pfam00514   4 NKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLAA 41
SRP1 COG5064
Karyopherin (importin) alpha [Intracellular trafficking and secretion];
10-299 3.58e-04

Karyopherin (importin) alpha [Intracellular trafficking and secretion];


Pssm-ID: 227396  Cd Length: 526  Bit Score: 42.96  E-value: 3.58e-04
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       10 YQDDAELATRAIPELTKLLNDED----QVVVNKAAVmvhqlskkeasrhaimrsPQMVSAIVRTMQNTNDVETARCTAGT 85
Cdd:COG5064  81 FSDDIEQQLQAVYKFRKLLSKETsppiQPVIDAGVV------------------PRFVEFMDEIQRDMLQFEAAWALTNI 142
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A       86 LHNLSHHREgllAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALL--NKTNVKFLA 163
Cdd:COG5064 143 ASGTTQQTK---VVVDAGAVPLFIQLLSSTEDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGLLlsSAIHISMLR 219
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G3J_A      164 ITTDCLQILAYG--------NQESKLIILASggpqaLVNIMRTYTYEKLLWTTSRVLKVLSVCSSnkpAIVEAGGMQALG 235
Cdd:COG5064 220 NATWTLSNLCRGknpppdwsNISQALPILAK-----LIYSRDPEVLVDACWAISYLSDGPNEKIQ---AVLDVGIPGRLV 291
                       250       260       270       280       290       300
                ....*....|....*....|....*....|....*....|....*....|....*....|....*..
1G3J_A      236 LHLTDPSQRLVQNCLWTLRNL---SDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNN 299
Cdd:COG5064 292 ELLSHESAKIQTPALRSVGNIvtgSDDQTQVIINCGALKAFRSLLSSPKENIRKEACWTISNITAGN 358
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
451-490 5.60e-04

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 38.97  E-value: 5.60e-04
                          10        20        30        40
                  ....*....|....*....|....*....|....*....|
1G3J_A        451 DVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELA 490
Cdd:pfam00514   1 SPENKQAVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNLA 40
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
98-130 7.76e-04

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 38.56  E-value: 7.76e-04
                           10        20        30
                   ....*....|....*....|....*....|...
1G3J_A          98 AIFKSGGIPALVKMLGSPVDSVLFYAITTLHNL 130
Cdd:smart00185   7 AVVDAGGLPALVELLKSEDEEVVKEAAWALSNL 39
Arm pfam00514
Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form ...
98-130 4.86e-03

Armadillo/beta-catenin-like repeat; Approx. 40 amino acid repeat. Tandem repeats form super-helix of helices that is proposed to mediate interaction of beta-catenin with its ligands. CAUTION: This family does not contain all known armadillo repeats.


Pssm-ID: 278915  Cd Length: 41  Bit Score: 36.27  E-value: 4.86e-03
                          10        20        30
                  ....*....|....*....|....*....|...
1G3J_A         98 AIFKSGGIPALVKMLGSPVDSVLFYAITTLHNL 130
Cdd:pfam00514   7 AVIEAGAVPPLVRLLSSPDEEVQEEAAWALSNL 39
ARM smart00185
Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form ...
451-491 4.98e-03

Armadillo/beta-catenin-like repeats; Approx. 40 amino acid repeat. Tandem repeats form superhelix of helices that is proposed to mediate interaction of beta-catenin with its ligands. Involved in transducing the Wingless/Wnt signal. In plakoglobin arm repeats bind alpha-catenin and N-cadherin.


Pssm-ID: 214547  Cd Length: 41  Bit Score: 36.25  E-value: 4.98e-03
                           10        20        30        40
                   ....*....|....*....|....*....|....*....|.
1G3J_A         451 DVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQ 491
Cdd:smart00185   1 DDENKQAVVDAGGLPALVELLKSEDEEVVKEAAWALSNLSS 41
 
Blast search parameters
Data Source: Precalculated data, version = cdd.v.3.16
Preset Options:Database: CDSEARCH/cdd   Low complexity filter: no  Composition Based Adjustment: yes   E-value threshold: 0.01

References:

  • Marchler-Bauer A et al. (2017), "CDD/SPARCLE: functional classification of proteins via subfamily domain architectures.", Nucleic Acids Res.45(D)200-3.
  • Marchler-Bauer A et al. (2015), "CDD: NCBI's conserved domain database.", Nucleic Acids Res.43(D)222-6.
  • Marchler-Bauer A et al. (2011), "CDD: a Conserved Domain Database for the functional annotation of proteins.", Nucleic Acids Res.39(D)225-9.
  • Marchler-Bauer A, Bryant SH (2004), "CD-Search: protein domain annotations on the fly.", Nucleic Acids Res.32(W)327-331.
Help | Disclaimer | Write to the Help Desk
NCBI | NLM | NIH