Conserved Protein Domain Family
Amb_V_allergen

?
smart00816: Amb_V_allergen 
Amb V Allergen
Amb V is an Ambrosia sp (ragweed) pollen allergen. Amb t V has been shown to contain a C-terminal helix as the major T cell epitope. Free sulphhydryl groups also play a major role in the T cell recognition of cross-reactivity T cell epitopes within these related allergens.
Statistics
?
PSSM-Id: 129052
View PSSM: smart00816
Aligned: 3 rows
Threshold Bit Score: 53.8061
Threshold Setting Gi: 114091
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P43175 22 KVMACYAAGSICGEKRGYCSSDPGRYCPWQVVCYESRKICAKNAA 66  Ambrosia psilostachya
P43174 22 KLLPCAWAGNVCGEKRAYCCSDPGRYCPWQVVCYESSEICSQKCG 66  Ambrosia psilostachya
P10414 34 DDGLCY-EGTNCGKVGKYCCSPIGKYC----VCYDSKAICNKNCT 73  giant ragweed
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap