Conserved Protein Domain Family
Alpha_TIF

?
smart00814: Alpha_TIF 
Alpha trans-inducing protein (Alpha-TIF)
Alpha-TIF (VP16) from Herpes Simplex virus is an essential tegument protein involved in the transcriptional activation of viral immediate early (IE) promoters (alpha genes) during the lytic phase of viral infection. VP16 associates with cellular transcription factors to enhance transcription rates, including the general transcription factor TFIIB and the transcriptional coactivator PC4. The N-terminal residues of VP16 confer specificity for the IE genes, while the C-terminal residues are responsible for transcriptional activation. Within the C-terminal region are two activation regions that can independently and cooperatively activate transcription. VP16 forms a transcriptional regulatory complex with two cellular proteins, the POU-domain transcription factor Oct-1 and the cell-proliferation factor HCF-1. VP16 is an alpha/beta protein with an unusual fold. Other transcription factors may have a similar topology.
Statistics
?
PSSM-Id: 129050
View PSSM: smart00814
Aligned: 12 rows
Threshold Bit Score: 453.364
Threshold Setting Gi: 296316013
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984476   28 ELPDAATAPRPYATGR--LSQAQIMPQPPVPVPPAALYNRLLEDLGFGDGPALCTILDSWNEDLFSGLPANPDLYRECQF 105
gi 66865980   32 LFGDVASDIGSETSLY--SHAVKTAPSPPWVASPKILYQQLIRDLDFSEGPRLLSCLETWNEDLFSCFPINEDLYSDMMV 109
gi 13242402   30 LLGDVQEHN--AGSLY---SSVQVGTPPPRVASPAVLYQQLINDLHFSEGPRIIALLETCNEDIFSCFPLNEDLYTDTIV 104
gi 126801890  33 sfdegmlSAIESVYSI--PTKKRLALPPPKAASPGALYQRLQGELGFPEGQTLLSAMEKWNEDMFSALPGHVDLYTEIAL 110
gi 26541476   12 LLGAVGYSNNFKGKQS--L--------PIKASSPSSLIKNLLDELNFPEGPSLLSSMEKWNEDLFSCIPRFLEIYIENSI 81
gi 12084877   43 IPPAFGGEAIDYTTPIiaPFSEKLSLPSPEAASPNLLYDRLILELDFAEGPSLLAKLERVNVDLFSCLPLNSHLYKHAKI 122
gi 78183397   25 GPKNTPAAPPLYATGR--LSQAQLMPSPPMPVPPAALFNRLLDDLGFSAGPALCTMLDTWNEDLFSGFPTNADMYRECKF 102
gi 10834919   50 LCSQTRCAEQSASFSLsaPFSIKISLPSPNPNPPNRLYNRLLHELDFTEGPSLLSRLEKLNVDLFSCFPINGHLYEHATL 129
gi 28395455    7 vvafdeallGGAAPGR--PP----VVAVPRAASPDALYQRLISDLAFDEGPALLSAMERWNEDLFSCLPGNEDLYARMVM 80
gi 125745100  47 llseievrtqsipsplvapsvtkmslpspspappnslYTRLLHELDFVEGPSILARLEKINVDLFSCFPHNKHLYEHAKI 126
gi 57790939   50 WLRNPGPPALVNAPKY--V--------RPSKCSASFLAKNALTELQFADWDKIQHVLKTINIDIFSCVPVGENGLCNMDW 119
gi 296316013  14 LLGPPPAA--GSAPDG--PSPARFALPPPRPAPLAALLERMQTELGFPEGPALLRAMERWNEDLFSCLPTNADLYADAAL 89
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984476  106 LSTLPSDVVA-W--GdgHTPD-R----GPIDIRAHGSAPFPSLPARREDLPAYCEALTRFFRAELRAREESYRRVLANFC 177
gi 66865980  110 LSPDPDDVIS-T--V--STKD-Hv---EMFNLTTRGSVRLPSPPKQPTGLPAYVQEVQDSFTVELRAREEAYTKLLVTYC 180
gi 13242402  105 FSTNPSDIIE-S--L--ETSE-Tp---EPINLITKG-CDLPSLPSTYTELPMYVENVQNTFFTELRVREKAYLRLLILYC 174
gi 126801890 111 LSTSVDEVVR-AglD--SLPT-PshysPEVDLNAHGDEPFPEVPALEDDLEIYVISAQRFYLSELRTREEHYARLLRGYC 186
gi 26541476   82 LSTSVDEVIKnL--D--NSLN-Yd---DVIDFQVHGPETFPKTPLLEEELENYVTSVQKYFLSELKAREVTYSFLLTKYC 153
gi 12084877  123 LSTCPREVLD-------AVYE-NtwqyTALNLNEHGKSSIPPVPASKDDLPAYVTAVQEFYLEELEAREQIYAKLFFGYC 194
gi 78183397  103 LSTLPSDVIE-W--GdaYVPE-R----SQIDIRAHGDVAFPTLPATRDGLASYYEAMAQFFRGELRAREESYRTVCANFC 174
gi 10834919  130 LSVSPSEVLD-A--A--SEEKwAy---TAINLNEHCGMEVPRPPLTKDGLPVYVTEIQKFFSMELEAREKSYVTLLCGYC 201
gi 28395455   81 LSASADEVAA-Q--V--QAPT-Ad---ASVDLGVPGAEPMPRVPAVEEELPAYVAAVERFFVSTLRAREERYARLLDAYC 151
gi 125745100 127 LSVSPSEVLE-E--L--SKNT-Wt--yTALNLNEHGEMALPMPPTTKADLPSYVDDIQNFYLGELEAREKSYATMFYGYC 198
gi 57790939  120 FSLDTEKIWT-LmdS--GTPN-V----SPNLLITPG--PPPECIKTPEEAPAYFEAISNYFESVLAAREAEYAKLLAEYA 189
gi 296316013  90 LSADADAVVG-AmyL--AVPG-Da---ERLDLNAHANQPLPAPPASEEGLPEYVAGVQAHFLAELRAREERYAGLFLGYC 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984476  178 SALYRYLRASTRQLHRQAALKGRPR-DLQEMLRAAVAERYYRETARLARVLFLHLYLFLVREILWAVYAEQVMRQDLFEG 256
gi 66865980  181 KSIIRYLQGTAKRTTIGLNIQNPDQ-KXYTQLRQSILLRYYREVASLARLLYLHLYLTVTREFSWRLYASQSAHPDVFAA 259
gi 13242402  175 KSLLRHLQGISRRSSVGARSQDCEH-KYITQFKQSIRLRYYREVAKLARLLYLHLYITVTRQFSWRLFAQQSKYPDVFAA 253
gi 126801890 187 VALLHYLYGSAKRQLRG---SGSDA-SLMHKFKQVVRDRYYREAANLARLLYLHLYVSVTREVSWRLHASQVINQGVFVS 262
gi 26541476  154 KALLLYLRYNTKSSIKGNKDINAFH-Q---KFKQNVRERYYREVANIARLLYLHLYLSVTREVSWKLHADQVLLQSVFVS 229
gi 12084877  195 RALIMHIIKSVLNESRGVRVSDDYV---QNKARWYISNNYYRDAVRIAKLLYLHLYLSTTRDVSQRLEAMQTSHQDLFVY 271
gi 78183397  175 SARYRYLRASVRQLHRQAHMRGRDR-DLREMLRTTIADRYYRETARLARVLFLHLYLFLTREILWAAYAEQMMRPDLFDG 253
gi 10834919  202 RALACYLRQGANEPSRCDMCVGGS-----ETPRRSIAGAYYREAARFARLLYMHLYLSVTRDVSRRLEASQRKRQNLFAD 276
gi 28395455  152 RAVLRYLHARARRD--------------EGRLRQLVRGRYYRDVARLARLLFLHLYVATARELSWRLHADQVVAQDVFTS 217
gi 125745100 199 RALAEYIRQSAIKDLRDARVEDKNI-GACSKARQYIAERYYREAARFAKLLYVHLYLSTTRDVSQRLEASQMGRQNIFVY 277
gi 57790939  190 KSLAKYIRHKSQKVGRGLRALELDTeEAKKRFTVLMKSEYYKGIEKLLIIFLVHLVLNACRDVARIIWVQQRDSSSVLQK 269
gi 296316013 163 RALLQHLRA----TAARGRGAAGAG-AQADRLRQLVAARYYREASALARLAFAHMYVATAREVSWRLHSQQSQAQGVFVS 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30984476  257 LCCDLEQARQLSCLFQPLLFVHGTVSVRGAAVAPARLREINYVRERLNLPLVRSAATEEPGAALTAAPALQTQRARSSGY 336
gi 66865980  260 LKFTWTERRQFTCAFHPVLCNHGIVLLEGKPLTASALREINYRRRELGLPLVRCGLVEENKSPLVQQPSFSVHLPRSVGF 339
gi 13242402  254 MKFMWLENRQFTCAFHPILCNHGIVLLEGKPLSSQRLREVNYRRRQLGLPLVRCALIEEKGVPLVQRPEFSAHMPRSLGF 333
gi 126801890 263 LHYFWAQRRKFECLFHPVLFNHGVVILENDPLEFHDLQRINYRRRELGLPLIRAGLIEEENSPLEAEPLFSGKLPRTIGF 342
gi 26541476  230 LSYSWSHRRQFECIFHPILFNHGIVNLENNPLTFKELQKINYRRHILGLPLIRAGLVEEDNQPLMIPPEFSSKLPRTIGF 309
gi 12084877  272 LRCEWGQGRQFWCIFQPMIYNHGVPMIEGRALTSLELGSSNYIRSELGLPLIRCELLEELESPVVFPPTFTATAPRSSGY 351
gi 78183397  254 LCCDLESWRQLACLFQPLMFINGSLTVRGVPVEARRLRELNHIREHLNLPLIRSAAAEEPGAPLTTPPVLQGNQARASGY 333
gi 10834919  277 LRCDWHQLRHFQCLFQPVIFNHGVVIVEGRALTAAELRTQNYVRSELGLPVMRCELVEERGMPLTAPPAFLANAPRASAY 356
gi 28395455  218 LRYEWDQTRQLTCLFHPVLFNHGVVLLAGAPVPAAQLRAVNRRRRELGLPLVRTGLIEEDGADLVEEPPFSAALPRAAGY 297
gi 125745100 278 LKCEWLQERHFHCLFQPVIFNHGVVIVEGRVLTAPELRAQNYIRSEFGLPLIRCKLVEEPDMPLISPPPFSGDAPRASVY 357
gi 57790939  270 VTYRW-ESQQLHCIFQPLLVSPGPVFLDNDPLPLQTLQHVNYVRYLLGVPVLRFSMIEE--SPSAQYIPYDKTAPSAYDV 346
gi 296316013 238 LYYAWPQRRQFTCLFHPVLFNHGVVALEDGFLDAAELRRLNYRRRELGLPLVRAGLVEVEVGPLVEEPPFSGSLPRALGF 317
                        330       340       350       360       370
                 ....*....|....*....|....*....|....*....|....*....|...
gi 30984476  337 FMTLIRVKLDAYSEGSGSEGA-EVLREHAYSRRRE-RT-NYGSSIEGL-L-EL 384
gi 66865980  340 LTHHIKRKLDAYAVKHPQEPR-HVRADHPYAKVVE-NR-NYGSSIEAMiL-AP 388
gi 13242402  334 LTHHIKAKLDVYSSKHSQEPG-NVRVDHPYARNVN-NI-NYGSSVEAMiV-SP 382
gi 126801890 343 LTHQIRTKMEAYSDAHPATPL-FPLAEHSYSKRIG-GRlSYGTTTEAM-M-DP 391
gi 26541476  310 LTQQIRAKMEAYSDNHPVTPK-FPRIEHSYAKPID-PI-NYGTTIEAM-M-DP 357
gi 12084877  352 LFHNIRAKMELYSNIHPSVPQlSGLSDHTYVRLTHvPV-NYGTTVEVL-LvDA 402
gi 78183397  334 FMLLIRAKLDSYSSVATSEGE-TVMREHAYSRGRH-RN-NYGSTIEGlldlpd 383
gi 10834919  357 LFQCIKSKLEVYSLMHPPRPRsSARGESGRAGKAG-PScGHGTIVKAM-LrDS 407
gi 28395455  298 LSHQVRIKMEAYSRE---------YRDHTYCRPPS-PVaSYGSTAEAL-L-PP 338
gi 125745100 358 LLQCIRSKLEVYSLSHPPNPQlHVHKEHVHVQKLEsPP-NYGTTVEAL-L-MD 407
gi 57790939  347 LATIARTCLTSSGCSRAS-------HDHTYARDNE-KP-NYSSSRIVL-LaDS 389
gi 296316013 318 LNYQVRAKMGAPAEAGGRL---APEREHSYARPRG-AI-NYGTTPEAM-L-RP 363
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap