Conserved Protein Domain Family
Alpha_TIF

?
smart00814: Alpha_TIF 
Alpha trans-inducing protein (Alpha-TIF)
Alpha-TIF (VP16) from Herpes Simplex virus is an essential tegument protein involved in the transcriptional activation of viral immediate early (IE) promoters (alpha genes) during the lytic phase of viral infection. VP16 associates with cellular transcription factors to enhance transcription rates, including the general transcription factor TFIIB and the transcriptional coactivator PC4. The N-terminal residues of VP16 confer specificity for the IE genes, while the C-terminal residues are responsible for transcriptional activation. Within the C-terminal region are two activation regions that can independently and cooperatively activate transcription. VP16 forms a transcriptional regulatory complex with two cellular proteins, the POU-domain transcription factor Oct-1 and the cell-proliferation factor HCF-1. VP16 is an alpha/beta protein with an unusual fold. Other transcription factors may have a similar topology.
Statistics
?
Aligned: 12 rows
Threshold Bit Score: 453.364
Threshold Setting Gi: 296316013
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_851908     28 ELPDAATAPRPYATGR--LSQAQIMPQPPVPVPPAALYNRLLEDLGFGDGPALCTILDSWNEDLFSGLPANPDLYRECQF 105 B virus
AAY57628      32 LFGDVASDIGSETSLY--SHAVKTAPSPPWVASPKILYQQLIRDLDFSEGPRLLSCLETWNEDLFSCFPINEDLYSDMMV 109 Varicella-zoste...
NP_077425     30 LLGDVQEHN--AGSLY---SSVQVGTPPPRVASPAVLYQQLINDLHFSEGPRIIALLETCNEDIFSCFPLNEDLYTDTIV 104 Simian varicell...
YP_053057     33 sfdegmlSAIESVYSI--PTKKRLALPPPKAASPGALYQRLQGELGFPEGQTLLSAMEKWNEDMFSALPGHVDLYTEIAL 110 Equine herpesvi...
AAN85477      12 LLGAVGYSNNFKGKQS--L--------PIKASSPSSLIKNLLDELNFPEGPSLLSSMEKWNEDLFSCIPRFLEIYIENSI 81  CaHV-1
NP_073342     43 IPPAFGGEAIDYTTPIiaPFSEKLSLPSPEAASPNLLYDRLILELDFAEGPSLLAKLERVNVDLFSCLPLNSHLYKHAKI 122 Turkey herpesvirus
BAE47065      25 GPKNTPAAPPLYATGR--LSQAQLMPSPPMPVPPAALFNRLLDDLGFSAGPALCTMLDTWNEDLFSGFPTNADMYRECKF 102 Chimpanzee alph...
NP_066880     50 LCSQTRCAEQSASFSLsaPFSIKISLPSPNPNPPNRLYNRLLHELDFTEGPSLLSRLEKLNVDLFSCFPINGHLYEHATL 129 Marek's disease...
AAO38920       7 vvafdeallGGAAPGR--PP----VVAVPRAASPDALYQRLISDLAFDEGPALLSAMERWNEDLFSCLPGNEDLYARMVM 80  Pseudorabies virus
YP_001033977  47 llseievrtqsipsplvapsvtkmslpspspappnslYTRLLHELDFVEGPSILARLEKINVDLFSCFPHNKHLYEHAKI 126 Marek's disease...
YP_182343     50 WLRNPGPPALVNAPKY--V--------RPSKCSASFLAKNALTELQFADWDKIQHVLKTINIDIFSCVPVGENGLCNMDW 119 ILTV
YP_003662477  14 LLGPPPAA--GSAPDG--PSPARFALPPPRPAPLAALLERMQTELGFPEGPALLRAMERWNEDLFSCLPTNADLYADAAL 89  BoHV-5
NP_851908    106 LSTLPSDVVA-W--GdgHTPD-R----GPIDIRAHGSAPFPSLPARREDLPAYCEALTRFFRAELRAREESYRRVLANFC 177 B virus
AAY57628     110 LSPDPDDVIS-T--V--STKD-Hv---EMFNLTTRGSVRLPSPPKQPTGLPAYVQEVQDSFTVELRAREEAYTKLLVTYC 180 Varicella-zoste...
NP_077425    105 FSTNPSDIIE-S--L--ETSE-Tp---EPINLITKG-CDLPSLPSTYTELPMYVENVQNTFFTELRVREKAYLRLLILYC 174 Simian varicell...
YP_053057    111 LSTSVDEVVR-AglD--SLPT-PshysPEVDLNAHGDEPFPEVPALEDDLEIYVISAQRFYLSELRTREEHYARLLRGYC 186 Equine herpesvi...
AAN85477      82 LSTSVDEVIKnL--D--NSLN-Yd---DVIDFQVHGPETFPKTPLLEEELENYVTSVQKYFLSELKAREVTYSFLLTKYC 153 CaHV-1
NP_073342    123 LSTCPREVLD-------AVYE-NtwqyTALNLNEHGKSSIPPVPASKDDLPAYVTAVQEFYLEELEAREQIYAKLFFGYC 194 Turkey herpesvirus
BAE47065     103 LSTLPSDVIE-W--GdaYVPE-R----SQIDIRAHGDVAFPTLPATRDGLASYYEAMAQFFRGELRAREESYRTVCANFC 174 Chimpanzee alph...
NP_066880    130 LSVSPSEVLD-A--A--SEEKwAy---TAINLNEHCGMEVPRPPLTKDGLPVYVTEIQKFFSMELEAREKSYVTLLCGYC 201 Marek's disease...
AAO38920      81 LSASADEVAA-Q--V--QAPT-Ad---ASVDLGVPGAEPMPRVPAVEEELPAYVAAVERFFVSTLRAREERYARLLDAYC 151 Pseudorabies virus
YP_001033977 127 LSVSPSEVLE-E--L--SKNT-Wt--yTALNLNEHGEMALPMPPTTKADLPSYVDDIQNFYLGELEAREKSYATMFYGYC 198 Marek's disease...
YP_182343    120 FSLDTEKIWT-LmdS--GTPN-V----SPNLLITPG--PPPECIKTPEEAPAYFEAISNYFESVLAAREAEYAKLLAEYA 189 ILTV
YP_003662477  90 LSADADAVVG-AmyL--AVPG-Da---ERLDLNAHANQPLPAPPASEEGLPEYVAGVQAHFLAELRAREERYAGLFLGYC 162 BoHV-5
NP_851908    178 SALYRYLRASTRQLHRQAALKGRPR-DLQEMLRAAVAERYYRETARLARVLFLHLYLFLVREILWAVYAEQVMRQDLFEG 256 B virus
AAY57628     181 KSIIRYLQGTAKRTTIGLNIQNPDQ-KXYTQLRQSILLRYYREVASLARLLYLHLYLTVTREFSWRLYASQSAHPDVFAA 259 Varicella-zoste...
NP_077425    175 KSLLRHLQGISRRSSVGARSQDCEH-KYITQFKQSIRLRYYREVAKLARLLYLHLYITVTRQFSWRLFAQQSKYPDVFAA 253 Simian varicell...
YP_053057    187 VALLHYLYGSAKRQLRG---SGSDA-SLMHKFKQVVRDRYYREAANLARLLYLHLYVSVTREVSWRLHASQVINQGVFVS 262 Equine herpesvi...
AAN85477     154 KALLLYLRYNTKSSIKGNKDINAFH-Q---KFKQNVRERYYREVANIARLLYLHLYLSVTREVSWKLHADQVLLQSVFVS 229 CaHV-1
NP_073342    195 RALIMHIIKSVLNESRGVRVSDDYV---QNKARWYISNNYYRDAVRIAKLLYLHLYLSTTRDVSQRLEAMQTSHQDLFVY 271 Turkey herpesvirus
BAE47065     175 SARYRYLRASVRQLHRQAHMRGRDR-DLREMLRTTIADRYYRETARLARVLFLHLYLFLTREILWAAYAEQMMRPDLFDG 253 Chimpanzee alph...
NP_066880    202 RALACYLRQGANEPSRCDMCVGGS-----ETPRRSIAGAYYREAARFARLLYMHLYLSVTRDVSRRLEASQRKRQNLFAD 276 Marek's disease...
AAO38920     152 RAVLRYLHARARRD--------------EGRLRQLVRGRYYRDVARLARLLFLHLYVATARELSWRLHADQVVAQDVFTS 217 Pseudorabies virus
YP_001033977 199 RALAEYIRQSAIKDLRDARVEDKNI-GACSKARQYIAERYYREAARFAKLLYVHLYLSTTRDVSQRLEASQMGRQNIFVY 277 Marek's disease...
YP_182343    190 KSLAKYIRHKSQKVGRGLRALELDTeEAKKRFTVLMKSEYYKGIEKLLIIFLVHLVLNACRDVARIIWVQQRDSSSVLQK 269 ILTV
YP_003662477 163 RALLQHLRA----TAARGRGAAGAG-AQADRLRQLVAARYYREASALARLAFAHMYVATAREVSWRLHSQQSQAQGVFVS 237 BoHV-5
NP_851908    257 LCCDLEQARQLSCLFQPLLFVHGTVSVRGAAVAPARLREINYVRERLNLPLVRSAATEEPGAALTAAPALQTQRARSSGY 336 B virus
AAY57628     260 LKFTWTERRQFTCAFHPVLCNHGIVLLEGKPLTASALREINYRRRELGLPLVRCGLVEENKSPLVQQPSFSVHLPRSVGF 339 Varicella-zoste...
NP_077425    254 MKFMWLENRQFTCAFHPILCNHGIVLLEGKPLSSQRLREVNYRRRQLGLPLVRCALIEEKGVPLVQRPEFSAHMPRSLGF 333 Simian varicell...
YP_053057    263 LHYFWAQRRKFECLFHPVLFNHGVVILENDPLEFHDLQRINYRRRELGLPLIRAGLIEEENSPLEAEPLFSGKLPRTIGF 342 Equine herpesvi...
AAN85477     230 LSYSWSHRRQFECIFHPILFNHGIVNLENNPLTFKELQKINYRRHILGLPLIRAGLVEEDNQPLMIPPEFSSKLPRTIGF 309 CaHV-1
NP_073342    272 LRCEWGQGRQFWCIFQPMIYNHGVPMIEGRALTSLELGSSNYIRSELGLPLIRCELLEELESPVVFPPTFTATAPRSSGY 351 Turkey herpesvirus
BAE47065     254 LCCDLESWRQLACLFQPLMFINGSLTVRGVPVEARRLRELNHIREHLNLPLIRSAAAEEPGAPLTTPPVLQGNQARASGY 333 Chimpanzee alph...
NP_066880    277 LRCDWHQLRHFQCLFQPVIFNHGVVIVEGRALTAAELRTQNYVRSELGLPVMRCELVEERGMPLTAPPAFLANAPRASAY 356 Marek's disease...
AAO38920     218 LRYEWDQTRQLTCLFHPVLFNHGVVLLAGAPVPAAQLRAVNRRRRELGLPLVRTGLIEEDGADLVEEPPFSAALPRAAGY 297 Pseudorabies virus
YP_001033977 278 LKCEWLQERHFHCLFQPVIFNHGVVIVEGRVLTAPELRAQNYIRSEFGLPLIRCKLVEEPDMPLISPPPFSGDAPRASVY 357 Marek's disease...
YP_182343    270 VTYRW-ESQQLHCIFQPLLVSPGPVFLDNDPLPLQTLQHVNYVRYLLGVPVLRFSMIEE--SPSAQYIPYDKTAPSAYDV 346 ILTV
YP_003662477 238 LYYAWPQRRQFTCLFHPVLFNHGVVALEDGFLDAAELRRLNYRRRELGLPLVRAGLVEVEVGPLVEEPPFSGSLPRALGF 317 BoHV-5
NP_851908    337 FMTLIRVKLDAYSEGSGSEGA-EVLREHAYSRRRE-RT-NYGSSIEGL-L-EL 384 B virus
AAY57628     340 LTHHIKRKLDAYAVKHPQEPR-HVRADHPYAKVVE-NR-NYGSSIEAMiL-AP 388 Varicella-zoster virus
NP_077425    334 LTHHIKAKLDVYSSKHSQEPG-NVRVDHPYARNVN-NI-NYGSSVEAMiV-SP 382 Simian varicella virus
YP_053057    343 LTHQIRTKMEAYSDAHPATPL-FPLAEHSYSKRIG-GRlSYGTTTEAM-M-DP 391 Equine herpesvirus 1
AAN85477     310 LTQQIRAKMEAYSDNHPVTPK-FPRIEHSYAKPID-PI-NYGTTIEAM-M-DP 357 CaHV-1
NP_073342    352 LFHNIRAKMELYSNIHPSVPQlSGLSDHTYVRLTHvPV-NYGTTVEVL-LvDA 402 Turkey herpesvirus
BAE47065     334 FMLLIRAKLDSYSSVATSEGE-TVMREHAYSRGRH-RN-NYGSTIEGlldlpd 383 Chimpanzee alpha-1 herpesvirus
NP_066880    357 LFQCIKSKLEVYSLMHPPRPRsSARGESGRAGKAG-PScGHGTIVKAM-LrDS 407 Marek's disease virus type 2
AAO38920     298 LSHQVRIKMEAYSRE---------YRDHTYCRPPS-PVaSYGSTAEAL-L-PP 338 Pseudorabies virus
YP_001033977 358 LLQCIRSKLEVYSLSHPPNPQlHVHKEHVHVQKLEsPP-NYGTTVEAL-L-MD 407 Marek's disease virus type 1
YP_182343    347 LATIARTCLTSSGCSRAS-------HDHTYARDNE-KP-NYSSSRIVL-LaDS 389 ILTV
YP_003662477 318 LNYQVRAKMGAPAEAGGRL---APEREHSYARPRG-AI-NYGTTPEAM-L-RP 363 BoHV-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap