1AVA,2QPU


Conserved Protein Domain Family
Alpha-amyl_C2

?
smart00810: Alpha-amyl_C2 
Click on image for an interactive view with Cn3D
Alpha-amylase C-terminal beta-sheet domain
This entry represents the beta-sheet domain that is found in several alpha-amylases, usually at the C-terminus. This domain is organised as a five-stranded anti-parallel beta-sheet.
Statistics
?
PSSM-Id: 129046
View PSSM: smart00810
Aligned: 27 rows
Threshold Bit Score: 93.509
Threshold Setting Gi: 52851182
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AVA_A       342 TRHGIHNESKLQIIEADADLYLAEIDGKVIVKLGPRYDVGNLIPGG--FKVAAHGNDYAVWEK 402 barley
NP_567714    362 NKNGIGSTSSVTIKAAEADLYLAMIDDKVIMKIGPKQDVGTLVPSN--FALAYSGLDFAVWEK 422 thale cress
AAA91883     287 KRNRICATSNVQIMASDSDLYIAMIHHKIIVKIGPKLDLGNLIPPN--YEVATSGQDYAVWEQ 347 potato
AAX33233     834 NRNKIHCRSTIQITKAERDVYAAIIDKKVAMKIGPGFYEPASGPQR--WSLAVEGNDYKVWEA 894 Actinidia chinensis
AAG52558     765 NRQKLHCRSEVNIDKSERDVYAAIIDEKVAMKIGPGHYEPPNGSQN--WSVAVEGRDYKVWEt 825 thale cress
AAX33231     840 NRNKLNCRSRVKITKAERDVYAAIIDEKVAIKIGPGHYEPASGPQN--WNKSLEGRDYKVWEA 900 cultivated apple
NP_001052697 386 KCQDIHSRSAVKILEASSDLYSAIVDDKLCMKIGD----GSWCPSGpeWKLAASGDRYAVWHK 444 Japanese rice
AAF17626     354 RRQDIHSRSTVRVLKAESNLYAAIVGEKICMKLGD----GSWCPSGrdWTLATSGHRYAVWHK 412 thale cress
AAF63239     355 KRQDIHSRSSITILEAQPNLYSAMIGEKVCMKIGD----GSWCPAGreWTLATCGHRYAVWNK 413 cultivated apple
CAH58639     355 KHQGIHSRSSIHIIEAQPNLYAANIGDKVSMKIGD----GSWCPSGkeWTLATSGHRYAVWQK 413 common plantain
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap