Conserved Protein Domain Family
TAF

?
smart00803: TAF 
TATA box binding protein associated factor
TAFs (TATA box binding protein associated factors) are part of the transcription initiation factor TFIID multimeric protein complex. TFIID is composed of the TATA box binding protein (TBP) and a number of TAFs. The TAFs provide binding sites for many different transcriptional activators and co-activators that modulate transcription initiation by Pol II. TAF proteins adopt a histone-like fold.
Statistics
?
PSSM-Id: 129039
View PSSM: smart00803
Aligned: 28 rows
Threshold Bit Score: 57.63
Threshold Setting Gi: 71026272
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_001322819   2 AKAKQETLRTIFKSLGLGvDNEASIMYTLVDHAQTRILNILGNALQITHKCKRNRLTVNDINIALE 67  Trichomonas vaginalis G3
XP_003318659  49 TVLPSESMKVVAESMGIA-QIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALK 113 chimpanzee
EAA08678      11 STLSLESIKVIAESIGVG-SLPDDAAKELADDVSYKLKQIVQDAVKFMHHSKRMKLSIADVDHSLK 75  Anopheles gambiae str. PEST
CAC19673      12 TLFPTESMKVIAESIGIS-QVPEETCQLLTEEVSYRIKEITQDALKFMSVGKRQKLTTCDIDSALR 76  Iberian ribbed newt
NP_001081232  10 TLLPSESMKVISESVGIS-QMSEETCQLLAQEVSFRIKEVTQDALKFMHVGKRQKLTPSDIDAALK 74  African clawed frog
NP_001085716  10 VELCQDSVRLTAESVGLD--ITDEVAALLAEDVCYRLRELTQFSAQGLRHSRRRRLTVEDFNRALR 73  African clawed frog
XP_002027433  19 SVYSAESIKVIAESIGVG-TLSDDAAKELGEDISIKLKRIVQDAAKFSNHAKRQKILISDIDMSLK 83  Drosophila persimilis
XP_650399      4 QKIPLDFIKSMLSANGFE-EMSDEMINLISEEAENSISELFNEATKFMRHSKRKILTIQDINSALK 68  Entamoeba histolytica HM-1:IMSS
CAF92633      10 AEVSRESVRLMAESAGV--ELDDDVAALLAEDS----------SSQFMRHAKRRKLTVEDFNRALR 63  spotted green pufferfish
T32410       258 ahqtpiftQTAAEMLGIT-SLNTEAAELLEFLSREKLKEIVRLSAKWTQKSARRRMAVADVEHAIR 322 nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap