Conserved Protein Domain Family
Agro_virD5

?
smart00795: Agro_virD5 
Agrobacterium VirD5 protein
The virD operon in Agrobacterium encodes a site-specific endonuclease, and a number of other poorly characterised products. This family represents the VirD5 protein.
Statistics
?
Aligned: 5 rows
Threshold Bit Score: 1456.68
Threshold Setting Gi: 18033180
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL57027   62 MRLGAAEQSACETWDGGDRPTWKDLILSARVNRINGSAWSFNAGETTSSAFVYEGVPLGEEERRTYEQWAEPAQPSWEEL 141 Agrobacterium tume...
NP_053399  62 MKLGAAEREAYENWCLSNRPTWKDLVLRARLDAIDSSAWLPDLGEESPLIFRYEGIPLGEGERQAYKEWQEEAQPTWEDL 141 Agrobacterium tume...
CAA31354   62 VKLGAAEREAFEKWGGSGRPTWKDLVVKARLDAIDSSAWLSDFDEDSPSTFRYEGIPLGEAERQAYKKWQGDAQPTRDDL 141 Agrobacterium rhiz...
NP_066752   1 MRLGAAERSAYETWDRADRPSWKDLILSARLNAIDSFAWNVDVGESTSSTFVYEGVPLAEGERRAYEEWVEPGQPSWQQL 80  Agrobacterium rhiz...
NP_059817  57 VKLGPAERAAYENWCEPGRPTWKDLIIKARVDPIDDVIWLRDLEEDTPSTFRYEGMPLGLGERKAYENWQEDAQPTWEDL 136 Agrobacterium tume...
AAL57027  142 VISARIEELNTLASIPNACGRCQTDQALRADASKRKREDLINQKKTFLEPFEYDGMRLGSPERAACKNWSKPHPPTSNEL 221 Agrobacterium tume...
NP_053399 142 VVNARMAVPDPCADVADEHNPLKEGEEFRSEASKRKRKKPIDQDENSPTSFYYDGMRLGEPEREAYDNWGNAEPPTWKDL 221 Agrobacterium tume...
CAA31354  142 IVNARLAELGQSGWIVDEYVSHEDVEDFRSDSLKRKRSNSADRDENPPASFRHDGMRLGEPERAAHDNWCEPEPPTWKDL 221 Agrobacterium rhiz...
NP_066752  81 VVNARIEELNTSAAIPNECSPLQ--EEFRSEAPKRKRTSSIGQKNGFPEPFEFDGMRLGSPEREAYENWSKPQPPSWKDL 158 Agrobacterium rhiz...
NP_059817 137 VVSARMTELGRPHGITGEYTSLAGSKNTSSISLKRKRSNLID-DENSSGSFSYDGMKLGEAERSAYGDWAEAEPPTWKDL 215 Agrobacterium tume...
AAL57027  222 IIEGRLRAISNSTWHNEl--DDSSIFEYEGMPLGQGERLAYEKWLEPAQPGWEDLVVDARIAELAElyPSASTEcEHGRF 299 Agrobacterium tume...
NP_053399 222 VLKARLDAIDSSAWLFAs-eGSSSTFEYEGIPLGEGERQAYKEWQEDAQPTWEDLVINARMAELEH--PSWITD-EHNSL 297 Agrobacterium tume...
CAA31354  222 ILKARLDAIDSSAWLPQlneDSPSTFRYEGIPLGEGELQAYEKWQGDAQPTWEHIVVNARLAELGH--AFWIAD-EHNAL 298 Agrobacterium rhiz...
NP_066752 159 IVDARLHAIDTSTWLNEs--NDTSVFEYEGVPLGEGERLAYEKWLEPAQPGWEDLVVDARVAELHQsaPTWCEH-Q---- 231 Agrobacterium rhiz...
NP_059817 216 VLRARVSSINDSAWLFDs-qTSSSSFEYNGVPLGEPERQALRQWQGDAQPTWEDLVVNARMAELCH--AGWIEG-QKGCF 291 Agrobacterium tume...
AAL57027  300 EEGEDVPLKERVRTFPVPIIAEQEVGVSFLYDGVALGAAERAAYDRWSKPDRPNWDDLILDAHQTAVEHDGFLRPAIGEA 379 Agrobacterium tume...
NP_053399 298 EENLEFRPDARQASLKDSTDQRKSSSASFIYDGMKLGEPEHAAYENWSKPERPSWEALILDARQASIASSSVSNSLLAKT 377 Agrobacterium tume...
CAA31354  299 EEAVESRSDASKHNLERPVDQEAGSSASFTYDGMRLGAPEYAAHKRWSKPKRPTWEDLILDARQAAIESASVSSLQIGKE 378 Agrobacterium rhiz...
NP_066752 232 -PGNDVSSNESGRISGVPINAEQVSRAFFVYDGVALGAAERAAHDRWNRPDRPTWEDLIIVARQAAIEGDAVSNGMIGKT 310 Agrobacterium rhiz...
NP_059817 292 EKRGEA-LHASERGSQRPIVQRTDSSDSFLYDGRRLGAPERTAYERWSKRERPTWEDLILDAHQARIESDAVTTQAIGQS 370 Agrobacterium tume...
AAL57027  380 TSSVFLYEGMSLGNAEREAYGRWRQPAQPRWQNLVVNARQAELDPSAWILDEHDPFEDSEAAAFPAQATRANTSQPALDN 459 Agrobacterium tume...
NP_053399 378 SSPVFLYEGMSLGDAERQAYGRWRQPAQPRWQNLVVNARLADLDPLAWIPDEHDPFAEAEALSPTSQSSGANKSNRALGN 457 Agrobacterium tume...
CAA31354  379 PSSVFLYEGKSLGDAERQAHGRWRQLAQPRWQNLVVNARLAELDPSVWIPDEHDPFEEGEVPTPAPQASTASKSNPTLGG 458 Agrobacterium rhiz...
NP_066752 311 SSSVFLYEGMLLGDAERQAYGRWRQLAQPRWQNLVVNARLAELDPAAWIPDEHDPSEHGGATGLLSQASTTNKSRLSLGD 390 Agrobacterium rhiz...
NP_059817 371 SSLVFLYEGKSLGCREREAYEKWRQPAQPRWQNLVVNARLAELDPSVWIADERDPLDDGDALGRPSYTSLTDRSDVPLDD 450 Agrobacterium tume...
AAL57027  460 QPVSHRPGFATGATRGKTHDANPSTGQPGTRRTLCFESSGRDVGEPQSVEDRNCFYGVGKVRRLGAKSYQRDEATTYSAS 539 Agrobacterium tume...
NP_053399 458 QSDSGRPAFAYLAAQEASHLQSPACSQLETRRALNFGSPGPDANPTESIAKCNRLDGVSKIKRLGTKGRRAVNATIHGGK 537 Agrobacterium tume...
CAA31354  459 QSESGRPDRAHE-TQETTHLQSPTRSQLETRRALYFGSPGRDAIQTESIANCDRSDGAGKVKRLGTKGRRAVNPITHGVN 537 Agrobacterium rhiz...
NP_066752 391 QPEARSPSLAREPAQQPTHVQNLTCAQLEARRALYFGPSGRDADQTASIADSNRLDEVSKVKRLGAKSRRGAKATAYDVI 470 Agrobacterium rhiz...
NP_059817 451 QSIYHRSDLVREQVSESSQKQFAACSESETIPVSWFTASGLDANNTENIAASDPVDGTGGVKRLGSKSDRTVTASIHDVN 530 Agrobacterium tume...
AAL57027  540 SSTKRLSPDIGRCIASSSPPKKAVVSKVDNIGTYGSRKNERVRLATETGKYESEHIFGFKVVHDILRSTKEGRRLERPMP 619 Agrobacterium tume...
NP_053399 538 FGAQGLLSEDCGQAAEPSPSEQTTRPRTDNIGTYASRKNERARLATETGKYESEHIFGFKVVHDTLRATKEGRRLERPMP 617 Agrobacterium tume...
CAA31354  538 SSVQGPLSDERGHEAPFSSSEQVVRSRGDNIGTYGSRKNERARLATETGKYESEHIFGFKVVHDTLRATKEGRRLERPMP 617 Agrobacterium rhiz...
NP_066752 471 SSAERLSSHEGCLTVQSTQPEKAACSRSDNIGTYGSRKNERARLATETGKYESEHIFGFKVVHDTLRSTKEGRRLERPMP 550 Agrobacterium rhiz...
NP_059817 531 SSTKRLLLNEFGLEAPRPSPEKTVRLRSDNIGTYGSRRNERMRLATETGAYESEHIFGFKAVHDTARATKEGRRLERPMP 610 Agrobacterium tume...
AAL57027  620 AYLECKSLHRQHVGTGKGRNRLVGRGWSDDASYRSDQRATLSDPVASEEGVAASNGYQLNQLGYAHQLANGGLQSETPAE 699 Agrobacterium tume...
NP_053399 618 AYLEYKELHRQHVGTGRGRTGLVGRGWPDDASYRADQRATLSDPVASAEGATASNGYQLNQLGYAHQLATHGLQSETPDG 697 Agrobacterium tume...
CAA31354  618 AYLECKELHRQHVGTGRGRTRLVGRGWPDDASYRSDQKGTLSDPVASAEGVTASNGYQLNQLGYAHQLANDGLQSESPDG 697 Agrobacterium rhiz...
NP_066752 551 AYLECKELHRQHVGTGRGRTRLVGRGWPDDASYRSDQRATLSDPVASTEGATASNGYQLNQLGYAHQLANDGLQSETPDG 630 Agrobacterium rhiz...
NP_059817 611 AYLEYKGLHRQHVGTGRGRTKLVGRGWPDDTSYRSDQRATLSDPVARSEGATASNGYQLNQLGYAHQLASDGLQSESPDG 690 Agrobacterium tume...
AAL57027  700 VIIPLQIATTSYNYTVSRDPVLLPPTKEQSSQLLHLGPRGQTEALLARETALTGKWPTREREQQVYREFLALHAIKKDLE 779 Agrobacterium tume...
NP_053399 698 VTMPIQVATISYNYTVSRDPVLSPPSKEQAPPLLHLGPRGQTEAVLARETALTGKWPTLERECQVYQRFLALYDVKKDLD 777 Agrobacterium tume...
CAA31354  698 LTMPIQVATTSYNYTVSRDPVLSPPSKEQASQLLHLGPRGQTEAVLARETALTGKWPTLERERQVYQQFLALYEIKQDLD 777 Agrobacterium rhiz...
NP_066752 631 VIMPLQVATTSYNYTVSRDPVLSPPSKEQAPELLHLGPRGQTEAVLARETALTGRWPTREREQQVYREFLALYDVKKDLE 710 Agrobacterium rhiz...
NP_059817 691 VALPIQVATTSYNYTVSRDPVLVPPDKNEAPQLLHLGPRGQTEAVLARETALTGKWPTLEREQQVYREFLALYDVKKDLE 770 Agrobacterium tume...
AAL57027  780 AKPISSRKKKAALVSALNRTAGLI-ARPYESWAVNRRVENRADKIDQPRTYDPRDHRRDESFGR 842 Agrobacterium tumefaciens
NP_053399 778 AKQLGVRQKKQALVAALNRTAGLIgASPLEAQSSTAKVEYTTDEPDERRVYDPRDRGRDKAFNR 841 Agrobacterium tumefaciens
CAA31354  778 AKQLGVRQKKQSLAAALDRTAALIgASPSKAQSQAAEGANGAEPPEERRVYDQRDRSRDNAFNR 841 Agrobacterium rhizogenes
NP_066752 711 AKTLGLRKKKAALVSALNRTAASIgTSPLKAQSSSAEVEKATHEFDERRVYDPRDRGRDKALQR 774 Agrobacterium rhizogenes
NP_059817 771 AKSVGVRQKKKEVSSALDRTARLIiTSPSKARSE-AETEKAIDELDDRRVYDPRDRAQDKAFKR 833 Agrobacterium tumefaciens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap