Conserved Protein Domain Family
Agro_virD5

?
smart00795: Agro_virD5 
Agrobacterium VirD5 protein
The virD operon in Agrobacterium encodes a site-specific endonuclease, and a number of other poorly characterised products. This family represents the VirD5 protein.
Statistics
?
PSSM-Id: 129031
View PSSM: smart00795
Aligned: 5 rows
Threshold Bit Score: 1456.68
Threshold Setting Gi: 18033180
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180  62 MRLGAAEQSACETWDGGDRPTWKDLILSARVNRINGSAWSFNAGETTSSAFVYEGVPLGEEERRTYEQWAEPAQPSWEEL 141
gi 10954979  62 MKLGAAEREAYENWCLSNRPTWKDLVLRARLDAIDSSAWLPDLGEESPLIFRYEGIPLGEGERQAYKEWQEEAQPTWEDL 141
gi 1333705   62 VKLGAAEREAFEKWGGSGRPTWKDLVVKARLDAIDSSAWLSDFDEDSPSTFRYEGIPLGEAERQAYKKWQGDAQPTRDDL 141
gi 10954817   1 MRLGAAERSAYETWDRADRPSWKDLILSARLNAIDSFAWNVDVGESTSSTFVYEGVPLAEGERRAYEEWVEPGQPSWQQL 80
gi 10955161  57 VKLGPAERAAYENWCEPGRPTWKDLIIKARVDPIDDVIWLRDLEEDTPSTFRYEGMPLGLGERKAYENWQEDAQPTWEDL 136
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 142 VISARIEELNTLASIPNACGRCQTDQALRADASKRKREDLINQKKTFLEPFEYDGMRLGSPERAACKNWSKPHPPTSNEL 221
gi 10954979 142 VVNARMAVPDPCADVADEHNPLKEGEEFRSEASKRKRKKPIDQDENSPTSFYYDGMRLGEPEREAYDNWGNAEPPTWKDL 221
gi 1333705  142 IVNARLAELGQSGWIVDEYVSHEDVEDFRSDSLKRKRSNSADRDENPPASFRHDGMRLGEPERAAHDNWCEPEPPTWKDL 221
gi 10954817  81 VVNARIEELNTSAAIPNECSPLQ--EEFRSEAPKRKRTSSIGQKNGFPEPFEFDGMRLGSPEREAYENWSKPQPPSWKDL 158
gi 10955161 137 VVSARMTELGRPHGITGEYTSLAGSKNTSSISLKRKRSNLID-DENSSGSFSYDGMKLGEAERSAYGDWAEAEPPTWKDL 215
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 222 IIEGRLRAISNSTWHNEl--DDSSIFEYEGMPLGQGERLAYEKWLEPAQPGWEDLVVDARIAELAElyPSASTEcEHGRF 299
gi 10954979 222 VLKARLDAIDSSAWLFAs-eGSSSTFEYEGIPLGEGERQAYKEWQEDAQPTWEDLVINARMAELEH--PSWITD-EHNSL 297
gi 1333705  222 ILKARLDAIDSSAWLPQlneDSPSTFRYEGIPLGEGELQAYEKWQGDAQPTWEHIVVNARLAELGH--AFWIAD-EHNAL 298
gi 10954817 159 IVDARLHAIDTSTWLNEs--NDTSVFEYEGVPLGEGERLAYEKWLEPAQPGWEDLVVDARVAELHQsaPTWCEH-Q---- 231
gi 10955161 216 VLRARVSSINDSAWLFDs-qTSSSSFEYNGVPLGEPERQALRQWQGDAQPTWEDLVVNARMAELCH--AGWIEG-QKGCF 291
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 300 EEGEDVPLKERVRTFPVPIIAEQEVGVSFLYDGVALGAAERAAYDRWSKPDRPNWDDLILDAHQTAVEHDGFLRPAIGEA 379
gi 10954979 298 EENLEFRPDARQASLKDSTDQRKSSSASFIYDGMKLGEPEHAAYENWSKPERPSWEALILDARQASIASSSVSNSLLAKT 377
gi 1333705  299 EEAVESRSDASKHNLERPVDQEAGSSASFTYDGMRLGAPEYAAHKRWSKPKRPTWEDLILDARQAAIESASVSSLQIGKE 378
gi 10954817 232 -PGNDVSSNESGRISGVPINAEQVSRAFFVYDGVALGAAERAAHDRWNRPDRPTWEDLIIVARQAAIEGDAVSNGMIGKT 310
gi 10955161 292 EKRGEA-LHASERGSQRPIVQRTDSSDSFLYDGRRLGAPERTAYERWSKRERPTWEDLILDAHQARIESDAVTTQAIGQS 370
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 380 TSSVFLYEGMSLGNAEREAYGRWRQPAQPRWQNLVVNARQAELDPSAWILDEHDPFEDSEAAAFPAQATRANTSQPALDN 459
gi 10954979 378 SSPVFLYEGMSLGDAERQAYGRWRQPAQPRWQNLVVNARLADLDPLAWIPDEHDPFAEAEALSPTSQSSGANKSNRALGN 457
gi 1333705  379 PSSVFLYEGKSLGDAERQAHGRWRQLAQPRWQNLVVNARLAELDPSVWIPDEHDPFEEGEVPTPAPQASTASKSNPTLGG 458
gi 10954817 311 SSSVFLYEGMLLGDAERQAYGRWRQLAQPRWQNLVVNARLAELDPAAWIPDEHDPSEHGGATGLLSQASTTNKSRLSLGD 390
gi 10955161 371 SSLVFLYEGKSLGCREREAYEKWRQPAQPRWQNLVVNARLAELDPSVWIADERDPLDDGDALGRPSYTSLTDRSDVPLDD 450
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 460 QPVSHRPGFATGATRGKTHDANPSTGQPGTRRTLCFESSGRDVGEPQSVEDRNCFYGVGKVRRLGAKSYQRDEATTYSAS 539
gi 10954979 458 QSDSGRPAFAYLAAQEASHLQSPACSQLETRRALNFGSPGPDANPTESIAKCNRLDGVSKIKRLGTKGRRAVNATIHGGK 537
gi 1333705  459 QSESGRPDRAHE-TQETTHLQSPTRSQLETRRALYFGSPGRDAIQTESIANCDRSDGAGKVKRLGTKGRRAVNPITHGVN 537
gi 10954817 391 QPEARSPSLAREPAQQPTHVQNLTCAQLEARRALYFGPSGRDADQTASIADSNRLDEVSKVKRLGAKSRRGAKATAYDVI 470
gi 10955161 451 QSIYHRSDLVREQVSESSQKQFAACSESETIPVSWFTASGLDANNTENIAASDPVDGTGGVKRLGSKSDRTVTASIHDVN 530
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 540 SSTKRLSPDIGRCIASSSPPKKAVVSKVDNIGTYGSRKNERVRLATETGKYESEHIFGFKVVHDILRSTKEGRRLERPMP 619
gi 10954979 538 FGAQGLLSEDCGQAAEPSPSEQTTRPRTDNIGTYASRKNERARLATETGKYESEHIFGFKVVHDTLRATKEGRRLERPMP 617
gi 1333705  538 SSVQGPLSDERGHEAPFSSSEQVVRSRGDNIGTYGSRKNERARLATETGKYESEHIFGFKVVHDTLRATKEGRRLERPMP 617
gi 10954817 471 SSAERLSSHEGCLTVQSTQPEKAACSRSDNIGTYGSRKNERARLATETGKYESEHIFGFKVVHDTLRSTKEGRRLERPMP 550
gi 10955161 531 SSTKRLLLNEFGLEAPRPSPEKTVRLRSDNIGTYGSRRNERMRLATETGAYESEHIFGFKAVHDTARATKEGRRLERPMP 610
                       570       580       590       600       610       620       630       640
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 620 AYLECKSLHRQHVGTGKGRNRLVGRGWSDDASYRSDQRATLSDPVASEEGVAASNGYQLNQLGYAHQLANGGLQSETPAE 699
gi 10954979 618 AYLEYKELHRQHVGTGRGRTGLVGRGWPDDASYRADQRATLSDPVASAEGATASNGYQLNQLGYAHQLATHGLQSETPDG 697
gi 1333705  618 AYLECKELHRQHVGTGRGRTRLVGRGWPDDASYRSDQKGTLSDPVASAEGVTASNGYQLNQLGYAHQLANDGLQSESPDG 697
gi 10954817 551 AYLECKELHRQHVGTGRGRTRLVGRGWPDDASYRSDQRATLSDPVASTEGATASNGYQLNQLGYAHQLANDGLQSETPDG 630
gi 10955161 611 AYLEYKGLHRQHVGTGRGRTKLVGRGWPDDTSYRSDQRATLSDPVARSEGATASNGYQLNQLGYAHQLASDGLQSESPDG 690
                       650       660       670       680       690       700       710       720
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 18033180 700 VIIPLQIATTSYNYTVSRDPVLLPPTKEQSSQLLHLGPRGQTEALLARETALTGKWPTREREQQVYREFLALHAIKKDLE 779
gi 10954979 698 VTMPIQVATISYNYTVSRDPVLSPPSKEQAPPLLHLGPRGQTEAVLARETALTGKWPTLERECQVYQRFLALYDVKKDLD 777
gi 1333705  698 LTMPIQVATTSYNYTVSRDPVLSPPSKEQASQLLHLGPRGQTEAVLARETALTGKWPTLERERQVYQQFLALYEIKQDLD 777
gi 10954817 631 VIMPLQVATTSYNYTVSRDPVLSPPSKEQAPELLHLGPRGQTEAVLARETALTGRWPTREREQQVYREFLALYDVKKDLE 710
gi 10955161 691 VALPIQVATTSYNYTVSRDPVLVPPDKNEAPQLLHLGPRGQTEAVLARETALTGKWPTLEREQQVYREFLALYDVKKDLE 770
                       730       740       750       760       770       780
                ....*....|....*....|....*....|....*....|....*....|....*....|....
gi 18033180 780 AKPISSRKKKAALVSALNRTAGLI-ARPYESWAVNRRVENRADKIDQPRTYDPRDHRRDESFGR 842
gi 10954979 778 AKQLGVRQKKQALVAALNRTAGLIgASPLEAQSSTAKVEYTTDEPDERRVYDPRDRGRDKAFNR 841
gi 1333705  778 AKQLGVRQKKQSLAAALDRTAALIgASPSKAQSQAAEGANGAEPPEERRVYDQRDRSRDNAFNR 841
gi 10954817 711 AKTLGLRKKKAALVSALNRTAASIgTSPLKAQSSSAEVEKATHEFDERRVYDPRDRGRDKALQR 774
gi 10955161 771 AKSVGVRQKKKEVSSALDRTARLIiTSPSKARSE-AETEKAIDELDDRRVYDPRDRAQDKAFKR 833
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap