Conserved Protein Domain Family
AgrD

?
smart00794: AgrD 
Staphylococcal AgrD protein
This family consists of several AgrD proteins from many Staphylococcus species. The agr locus was initially described in Staphylococcus aureus as an element controlling the production of exoproteins implicated in virulence. Its pattern of action has been shown to be complex, upregulating certain extracellular toxins and enzymes expressed post-exponentially and repressing some exponential-phase surface components. AgrD encodes the precursor of the autoinducing peptide (AIP).The AIP derived from AgrD by the action of AgrB interacts with AgrC in the membrane to activate AgrA, which upregulates transcription both from promoter P2, amplifying the response, and from P3, initiating the production of a novel effector: RNAIII. In S. aureus, delta-hemolysin is the only translation product of RNA III and is not involved in the regulatory functions of the transcript, which is therefore the primary agent for modulating the expression of other operons controlled by agr.
Statistics
?
PSSM-Id: 129030
View PSSM: smart00794
Aligned: 21 rows
Threshold Bit Score: 58.8151
Threshold Setting Gi: 18250976
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL65807      1 MKLVNLLLSSTTSFLQMVGNRQKAKTCTVLYDEPEVPKELTQELE 45  Staphylococcus auricularis
YP_002634636  1 MDILNGIFKFFAFIFEQIGNIAKYNPCVGYFDEPEVPSELLDEQK 45  Staphylococcus carnosus subsp. carnosus TM300
AAL65833      1 MNILDSLLNLATKFFSALGASVGARPCGGFFDEPEVPAEITELHK 45  Staphylococcus gallinarum
ZP_04817300   2 MQIINLLFKVITAVFEKIGFIAGYSTCSYYFDEPEVPKELLEIYK 46  Staphylococcus epidermidis M23864:W1
AAL65854      1 MNIFESILNLFAKFFSVLGVMAGAKPCGGFFDEPEVPSEITKLYE 45  Staphylococcus xylosus
AAL65827      1 MHIFESIINLFVKFFSVLGAVSGGKVCSAYFDEPEVPKEITDLYK 45  Staphylococcus cohnii subsp. cohnii
AAL65848      1 MELLNGIFKLFAFIFEKIGNLAKYYPCFGYFDESEVPQELLDEDK 45  Staphylococcus simulans
AAL65845      1 MDLLNGIFKLFAFIFEKIGNLAKYNPCLGFLDEPTVPKELLEEDK 45  Staphylococcus simulans
AAL65821      4 MQIFDLLFKVISFIFEKIGFLAGYRTCNTYFDEPEVPKELFETYQ 48  Staphylococcus caprae
AAL65836      1 MRILEVLFNLITNLFQSIGTFARIPTSTGFFDEPEIPAELLEEEK 45  Staphylococcus intermedius
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap