1AOR,1B25


Conserved Protein Domain Family
AFOR_N

?
smart00790: AFOR_N 
Click on image for an interactive view with Cn3D
Aldehyde ferredoxin oxidoreductase, N-terminal domain
Enzymes of the aldehyde ferredoxin oxidoreductase (AOR) family contain a tungsten cofactor and an 4Fe4S cluster and catalyse the interconversion of aldehydes to carboxylates. This family includes AOR, formaldehyde ferredoxin oxidoreductase (FOR), glyceraldehyde-3-phosphate ferredoxin oxidoreductase (GAPOR), all isolated from hyperthermophilic archea. carboxylic acid reductase found in clostridia. and hydroxycarboxylate viologen oxidoreductase from Proteus vulgaris, the sole member of the AOR family containing molybdenum. GAPOR may be involved in glycolysis. but the functions of the other proteins are not yet clear. AOR has been proposed to be the primary enzyme responsible for oxidising the aldehydes that are produced by the 2-keto acid oxidoreductases.
Statistics
?
PSSM-Id: 129026
View PSSM: smart00790
Aligned: 59 rows
Threshold Bit Score: 173.472
Threshold Setting Gi: 15669374
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1AOR_A        5 WGRFIRVNLSTGDIKVEEYDEELAkkwLGSRGLAIYLLLKEMDPTVDPLSPENKLIIAAGPLTGTSAPTGGRYNVVTKSP 84  Pyrococcus furio...
NP_348637     7 dNNIVYINLSEKKVTYERITCEYRkkyIGGTGINTKILFESEAMYNDALSEKNVLIFGAGAAVGTSLLTGNRSTITAKSP 86  Clostridium acet...
NP_906641     2 AEMIYRVNMSEKSFSISECPKEWQe--FGGRGLTSAIVAAEVDPLCHPLGANNKLVFAPGSLSGTTAANSGRTSVGAKSP 79  Wolinella succin...
ZP_01312665   1 MDKIFRVNMTDLTTTVEDVPAEWAg--LGGRALTSTIVATEVDPECHPLGEKNKLVFAPGLLSGTAAAQSGRMSCGAKSP 78  Desulfuromonas a...
YP_066212     2 ADKIFRVNMADLSTKIEDVPEAWMg--HGGRGLTSTIVAAEVVPTCHPLGEDNKIVIAPGLLSGTTASNSGRISVGAKSP 79  Desulfotalea psy...
YP_010398     1 MPRILRINTRERSWRFEE-PGKYAg--LGGRSLTSRLVQDEVPADTHALSAENRIVAAIGLLSGTGAANSGRISIGAKSP 77  Desulfovibrio vu...
YP_006105     1 mwRSLRVDLKARKAYWQEVPPEEVa--FGGRYRTGQVLLEREAYRVDPLSPENPLVFAVGPLAGTGFSNANRTSVGTRSP 78  Thermus thermoph...
AAC70892      2 KFSVLKLDVGKREVEAQEIEREDI---FGVVDYGIMRHNELRTYEVDPYDPRNIVIFGIGPFAGSVLPGSHRLVFFFRSP 78  Pyrococcus furio...
YP_184576     2 KFTVLHLKLDERKVESEEFEKEGV---YGIIDYGLELHERLGTHSIEPYDPKNVVVMGMGPFSGSILPGAHRLMFFFRSP 78  Thermococcus kod...
NP_127254     2 KFSVLKIDVEKKDIKLEDFEREDI---YGIIDYGIYVHTQLKTYELEPYDPRNVMIIGKGPFAGSALPGSHRLVFFYRSP 78  Pyrococcus abyss...
1AOR_A       85 LTGFITMANSGGYfGAELKFAGYDAIVVEGKAE---K--PVYIYI-KD-E---------HIEIRDASHIW-----GKKVS 143 Pyrococcus furio...
NP_348637    87 LTDIYGDSNIGGSfPTTMRSVGIDHLVFQGKSE---N--PIYIFIdEK-G---------NVKFEDASDLW-----GFYTD 146 Clostridium acet...
NP_906641    80 LTNGIKESNVGGTsAQAFAKLGIKALIIEGAAP---EgqFYRLHI-TK-D---------NVEFIDAKEIL-----GKNNR 140 Wolinella succin...
ZP_01312665  79 LTGGIKESNAGGTtAQQFARMGIKAMIIEGMPKe-dK--FYSLHI-TK-D---------GVTIAEESELL-----GSGNF 139 Desulfuromonas a...
YP_066212    80 LTGTIKESNSGGTaAQFLARCGCKAIIIEGLPK---GdaWYNLAV-SP-E---------GITIAEESEVL-----GMGNM 140 Desulfotalea psy...
YP_010398    78 LTGGIKESNSGGSfCQKLARLDILALVLEDKPEpnaP--LVNIVL-TK-D---------GVRFDEAGDMA-----GKGTY 139 Desulfovibrio vu...
YP_006105    79 LTLGIKEANGGGTfGYALGQLRLAHLVLEGESP---E--WVVLRL-TRsG---------EVHFDPAQDLL-----GLGNF 138 Thermus thermoph...
AAC70892     79 LYGGLFPSTMGGA-GYQFKNVGVDFVEIHGKAE---K--PTVIIL-KN-DgeklsvdfyEIELEKLLDVWkeykgEEGVY 150 Pyrococcus furio...
YP_184576    79 LYGTLFPSAMGGA-AYAFKNVGVDFVTFEGKAE---K--PVVVIL-YN-DgsninvelhEIELEKLIEIWkdykgEEGVY 150 Thermococcus kod...
NP_127254    79 LYGTLFPSTMGGA-SYQFQHVGVDFVEIHGKAE---K--PVVIIM-KN-DgeeisvnfyELEMDKLIEIWegykgEEGVY 150 Pyrococcus abyss...
1AOR_A      144 ETEATIR-KEV-Gs----eKVKIASIGPAGENlVKFAAI-M----ND----G----H----RA----------AG----- 185 Pyrococcus furio...
NP_348637   147 KTTDILS-KRH-N------NCEISCIGPAGENlIRYASV-F----MS----K----T----HV----------AG----- 186 Clostridium acet...
NP_906641   141 YVTEKML-ELY-Gr-----KVSVLTIGRAGENrMLVSNIsV----KD----P----Dgk-lRS----------MG----- 185 Wolinella succin...
ZP_01312665 140 AVIDAMV-EKYdK------KIGVMTIGLPGELkMASANIsV----KD----P----Dgk-iRS----------HG----- 184 Desulfuromonas a...
YP_066212   141 AAIKIIKaRTD-D------KIALMLTGPAGEMkMSAANI-SitdpSN----D----I----RS----------CG----- 185 Desulfotalea psy...
YP_010398   140 ACMDAVS-ERY-Gk-----KACAMLIGPAGESlLTGASIqF----SDpwgrP----A----RA----------AG----- 185 Desulfovibrio vu...
YP_006105   139 EAARRLF-AAY-Gq-----RIAFALLGPVGEYlGLLSGIaF----SD----I----DgrpsRL----------AA----- 184 Thermus thermoph...
AAC70892    151 ALTQYLL-DNL-AsvfegmEFRIAVVGPAALN-TNMGAI-F----SQ----AlrngK----RA----------VGsedwa 204 Pyrococcus furio...
YP_184576   151 ALTQYLI-DTF-Gerf-dfEYRIAVVGPAALN-SNYGAI-F----SQ----T----L----RKgkrvegsedwAA----- 204 Thermococcus kod...
NP_127254   151 ALTQYLL-DNL-SsefegmEFRIAVVGPAALN-TNYGAV-F----SQ----AlrngK----RA----------VGsedwa 204 Pyrococcus abyss...
1AOR_A      186 -RGGVGAV-MGSKNLKAIAVeG 205 Pyrococcus furiosus DSM 3638
NP_348637   187 -RMGMGCI-MGSKKLKAIVIeR 206 Clostridium acetobutylicum ATCC 824
NP_906641   186 -RGAMGAV-MGSKGLKCVTVdQ 205 Wolinella succinogenes DSM 1740
ZP_01312665 185 -RGGMGAV-MGSKKIKFMTVdS 204 Desulfuromonas acetoxidans DSM 684
YP_066212   186 -RGGLGAV-MGSKKIKFITIkP 205 Desulfotalea psychrophila LSv54
YP_010398   186 -RGGLGAV-MGSKRVKAIVIdD 205 Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough
YP_006105   185 -RGGVGAV-MGRKRVKAIVVev 204 Thermus thermophilus HB27
AAC70892    205 aRGGPGSVlLRAHNVVAIAFgG 226 Pyrococcus furiosus DSM 3638
YP_184576   205 -RGGSGSVlLRAHNVVGIIFgG 225 Thermococcus kodakarensis KOD1
NP_127254   205 aRGGTGSVlLRAHNVVAIAFgG 226 Pyrococcus abyssi GE5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap