Conserved Protein Domain Family
SHR3_chaperone

?
smart00786: SHR3_chaperone 
ER membrane protein SH3
This family of proteins are membrane localised chaperones that are required for correct plasma membrane localisation of amino acid permeases (AAPs). Shr3 prevents AAPs proteins from aggregating and assists in their correct folding. In the absence of Shr3, AAPs are retained in the ER.
Statistics
?
PSSM-Id: 129022
View PSSM: smart00786
Aligned: 14 rows
Threshold Bit Score: 223.799
Threshold Setting Gi: 67522777
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_958487  18 YRGSGSFSTFIIIGPVCFFLGILFAQFPYDFPLLWTSEPVQATYYDFLEtHVKFLHASPLIISRILNIVIFVGLLGFFMK 97  Neurospora crassa ...
NP_010069   4 YSDFCSIGTAMILSATTFLMGVFFSNMPYDYHLLFNPNSTQEHFDLALR-HYQILHETPLPVIVTLCVVAGIGLVGGTIK 82  Saccharomyces cere...
XP_453431   5 YKDFCAVGTALIIGSTTFLMGIFFSNQPYDYNILFNPAATPEHFENALK-HYQTLFYTAKPTLYMLGAVAIVGVIGSLIR 83  Kluyveromyces lact...
XP_446613   4 YAEFCTIGSAMILTSTGFLMGVFFACQPYDYHLLFNPQATQEQFDLALK-HYQVLSTTPMPVLYLLGFVVALGIIGNTIR 82  Candida glabrata C...
XP_460522   3 YKDIVPVGSGLIIGATSFGLGVLYANLPYDVNTLWRQDETGTAFITSLA-HYSVWGNSPAYVHHIFHSVIGLGFIGAFIK 81  Debaryomyces hanse...
XP_711608   4 YKDIVPIGTSLIIGSTCFGLGIIYGNWPYDLNTLWIHD-IPEAFDASLR-HYQQWGNSPMYVHYTLHAVGLLGLIGHFIK 81  Candida albicans S...
NP_982810   6 YKDACTVGSALIVSATTFIMGVFFANQAYDYHLLFNANMTQEHYDNALR-HYQTLYFTAQPVLYIFGAIAIFGLLGSLIR 84  Ashbya gossypii AT...
XP_751860  27 FLFRTTILTRLPKTAVSFFLGIIFSLFPYDYPILWSTAPTPPAHYDYLEaHLRFLHASPPLIPRILHIVIFLGLAGLVSK 106 Aspergillus fumiga...
XP_504322   2 PTSASSISSALILCATSFSLGVLYSNWPYDFFTLWTAAPPESRYTASLD-HYKAWYDCPMFVYHIHHTVIGLGLIGFFIK 80  Yarrowia lipolytic...
XP_659449   2 TLRYGSFATFLIVCPTSFFLGIIFSLFPYDYPILWSTSPTDSTAYDSLEtHLRLLHASPPLIPRILHIVIFLGLAGLIMK 81  Aspergillus nidula...
XP_958487  98 LFRPAESNVLFDGASLILYVIGVGVYTSNIVKGMRTITAGIWDMedfagikhdgpvsgeviLGREDTMKVLSASNTILAM 177 Neurospora crassa ...
NP_010069  83 VFKPNPELQMFEYCSLGLYVLAICVFLTNVKTGIDCSVSHNWGE-----------------VTENQGLAVIASSNIILLV 145 Saccharomyces cere...
XP_453431  84 VYKPNPDLQLFEYGSLALYVLGICVFLTNIKTGVESAVYHNWGE-----------------VSEAQGIAVVASSNIIILI 146 Kluyveromyces lact...
XP_446613  83 IYKPNPDLQLFEYASLGLFVLAVCVFITNVKTGIECSITGNWGE-----------------VTQNQGLAVIASSNIILLV 145 Candida glabrata C...
XP_460522  82 LYKPSEDAKYFEYGSLFLYMVGVIIYLTNLRIGVNSCLAGDWGE-----------------VDMPTGINVMAASQVMIGF 144 Debaryomyces hanse...
XP_711608  82 LYKPDEDAKYFEYGSLGLFMVGVVIYLTNLRTGVNSCLVGQWGD-----------------VDYQTGINVMAASQVMIIF 144 Candida albicans S...
NP_982810  85 IYKPNPELQLFEYGSLAMYVLGVCVFLTNIKTGINSAHYGNWGE-----------------VTQNQGLAVIASSNIILLV 147 Ashbya gossypii AT...
XP_751860 107 LYRPSESNMLFDGASLVLYMCGITVYIANIVKGLRLASAGKYGEelatsp-----eekdqiLNREDSLKVLSASNTILAL 181 Aspergillus fumiga...
XP_504322  81 LYKPSESNKLFDGGSLFLYMVGVTIYLTNIRRGLASAVDGNWGD-----------------VDEHTGINVIAASQVMIVF 143 Yarrowia lipolytic...
XP_659449  82 LWKPSESNMLFDGASLVLYACGITVYVANIVKGLRLASGGVYGA------------------------ELANAPD----- 132 Aspergillus nidula...
XP_958487 178 VLVGVLVLQAGQWYAE---SKEKDDYAKGDKK-------EKKNDGqqqQQ--QQQQPQPVEEKKSQ 231 Neurospora crassa OR74A
NP_010069 146 MFAGVIILQIGLWYSNwdlQKRLKEFYAQEER-------EAANAG---KKt-EKVDNAKKNDNKSK 200 Saccharomyces cerevisiae S288c
XP_453431 147 VFAGVLVLQGGLWYSTweyEQRLDQWRKDQLK-------ESAANQ---QKaeKTTEPAKTESKKKK 202 Kluyveromyces lactis NRRL Y-1140
XP_446613 146 MFLGVILLQIGLWYTNydyQKQLQAFYAEERK-------EQEAIN---QR--KEEEfkklskkqqk 199 Candida glabrata CBS 138
XP_460522 145 ALFGVLLLQGGLYYAEwydNRLKVKFFEEEER-------AALAAA---SA--KTDNLAESEVVgsk 198 Debaryomyces hansenii CBS767
XP_711608 145 VLLGVLLLQGGLYYAQwydNKLKEEFYRQEAK-------EAALAA---ES--QAQQEHDIATKGKK 198 Candida albicans SC5314
NP_982810 148 VFVGVLVLQGGLWYSEweyEQRLETFMAEQEA-------ENSAAP---Kepakggkksakskke-- 201 Ashbya gossypii ATCC 10895
XP_751860 182 VLVGVLVLQAGQWYAErkdAQEYESLRKGHKEgggggasSSSASG---AA--AAAKPGRQGSVKKK 242 Aspergillus fumigatus Af293
XP_504322 144 VLLGVLGLQVGQWWAEredAKLKKKFDDEEKK-------E------------KKDKKESKESKKTK 190 Yarrowia lipolytica CLIB122
XP_659449 133 --------EAGQWYAErkdAQEDESFAAV-----------------------KGEGKGKGATKKKA 167 Aspergillus nidulans FGSC A4
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap