Conserved Protein Domain Family
AARP2CN

?
smart00785: AARP2CN 
AARP2CN (NUC121) domain
This domain is the central domain of AARP2. It is weakly similar to the GTP-binding domain of elongation factor TU.
Statistics
?
PSSM-Id: 129021
View PSSM: smart00785
Aligned: 55 rows
Threshold Bit Score: 86.0705
Threshold Setting Gi: 84999930
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_724863     221 EIRNLCKFLSVMKRPLISWREQHGYILGLKLDIEDSEfcksehksgllkdEDNFVDSediqlgkflnkcdddiSVYVEGY 300  Plasmodium yo...
NP_001067728  228 DLHKFMWLFKEQHLSCPHWRNQRPYVMSEEACIKPDD-------------SSGLC------------------TLLMSGY 276  Japanese rice
AAL13820       39 EALNVMRRIGGQKKRILHNVANRPHLFGDVVEFKP-G-------------SDPSDDLg---------------TLEVTGF 89   fruit fly
XP_002630359  229 DNLQLLRTLNETKKKPLTLQARHSYMLVENLE-ATES-------------PEDSSKI----------------TLKAQGY 278  Caenorhabditi...
XP_642295     247 ECSQVLRYIENIHVNEIIWRKVRPYMLIEKSSYIPET-------------------K----------------VVTIDGF 291  Dictyostelium...
XP_001680952  277 DYTKILRHMQVSKIRTLKWRDQHPYMAVEEKAYNPET-------------QE----------------------LTITGH 321  Leishmania ma...
XP_846975     251 DYDPVLRHLHVAKLRSLAWRDQHPYLIVEEGYFDDDA-------------Q----------------------KLVVGGY 295  Trypanosoma b...
XP_626073     230 DIRNLLSSIPNMGYSKICLREGRGYMLSESSSIVVNN-------------YSNEEKC----------------QLVIRGF 280  Cryptosporidi...
XP_729405     253 nFHKLYYEIMNMKVKNVSFREGRGYMMIDSYAYNP-------------------YND----------------SIYLKGF 297  Plasmodium yo...
XP_816950     252 EYDSLLRHLQVTKLRSLLWREQHPYLVVEQGSYLSDT-------------Q----------------------KLIIGGY 296  Trypanosoma c...
XP_724863     301 IYGSKMYKNQNVHIPNIGDVQIKNIKLLDDPF 332  Plasmodium yoelii yoelii str. 17XNL
NP_001067728  277 LRAHNLSVNQLVHLSGVGDFQLGQIDILKDPF 308  Japanese rice
AAL13820       90 LRGQSLNVNGLVHIPGLGDFQLSQVVAPPDPY 121  fruit fly
XP_002630359  279 LRGPEWNANNLIHLPGFGDFQISKIETAADPH 310  Caenorhabditis briggsae
XP_642295     292 IRGNNLSAKQIIHIPDYGDFQIEKIELIDDPH 323  Dictyostelium discoideum AX4
XP_001680952  322 LRGMPLSATQLVHLTNHGTFQVCKIEEVrkgd 353  Leishmania major strain Friedlin
XP_846975     296 LRGMALSAEQLIHLTNHGTFQIENICR-GDPr 326  Trypanosoma brucei TREU927
XP_626073     281 VRGVGLSMNFPVHITNIGDFVIDEIRPIDDPl 312  Cryptosporidium parvum Iowa II
XP_729405     298 VKGTGFNVHNPIHITNIGDYYLNDIYAIDamk 329  Plasmodium yoelii yoelii str. 17XNL
XP_816950     297 LRGMSISSKQLIHLTNYGTYQIEGISF-NDPt 327  Trypanosoma cruzi strain CL Brener
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap