Conserved Protein Domain Family
PhnA_Zn_Ribbon

?
smart00782: PhnA_Zn_Ribbon 
PhnA Zinc-Ribbon
This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Statistics
?
PSSM-Id: 129018
View PSSM: smart00782
Aligned: 7 rows
Threshold Bit Score: 81.0039
Threshold Setting Gi: 24373151
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_268316   6 ALKNRSNNSCELCTSTDTLVVYPVPPTSDLSAQQSIYLCQNCLSQID 52  Colwellia psychrerythraea 34H
YP_206541   6 TLLTRCDSKCELCGSTNSLAPFAVPPKTDITVDNCVMICDTCTAQIE 52  Vibrio fischeri ES114
NP_800368   6 TLLARCESKCELCSSESPLTAYAVPPHGNVTVDTAIMVCDKCHSEIE 52  Vibrio parahaemolyticus RIMD 2210633
NP_232939   9 TLLERCQSQCELCAASTPLSPFVVAPHALVTVDHAVMLCDTCKGQIE 55  Vibrio cholerae O1 biovar eltor str. N16961
YP_132362   6 ALKQRSDSKCELCASDSNLTVHAVAASPDSSAGNCVLLCETCHSQIE 52  Photobacterium profundum SS9
YP_065623   6 ELYARSESKCELCNAIENLVVFAVPPESAANADKSVLICSHCAEQIE 52  Desulfotalea psychrophila LSv54
NP_717194   5 ELLTRCGGKCELCGSDVELAIYDLPASDGH--ENEIMICENCSSQIA 49  Shewanella oneidensis MR-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap