Conserved Protein Domain Family
Citrate_ly_lig

?
smart00764: Citrate_ly_lig 
Citrate lyase ligase C-terminal domain
Proteins of this family contain the C-terminal domain of citrate lyase ligase EC:6.2.1.22.
Statistics
?
PSSM-Id: 129003
View PSSM: smart00764
Aligned: 20 rows
Threshold Bit Score: 293.767
Threshold Setting Gi: 42527030
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
YP_050665 157 IGAIVMNANPFTLGHRYLAEHAAQSCDWLHVFVVREDVSFFPFSERLEMVQRGVEHIHNLTVHAGSNYMISKATFPAYFL 236 Pectobacterium atr...
NP_603226 144 IASLIMNANPFTLGHQYLVEKASSENDVLHLFIVSDDSSLVPFEVRKKLVIEGTKYLKNICYHETGDYIISSATFPSYFQ 223 Fusobacterium nucl...
YP_193802 151 IAAIVMNANPFTLGHKHLVKMASEENDLVYVFVVANDVSLFNFDERMKLVKEGTKEFDNVKIVSGGDYMVSPATFPAYFL 230 Lactobacillus acid...
BAB83947  148 tAALVINANPFTLGHQYLVEKAAAENELLHLFMVSDDSSLIPFSVRKQLILAGTEHLSNICYHETGPYIISKSIFPSYFQ 227 Streptococcus mutans
CAB60040  149 KASIVMNANPFTLGHRYLVEQASKENDHVYIFVVNQDVSLFTIAERFNLVKQGVVDLDNVDVINGQEYMVSYLSFSSYFI 228 Weissella paramese...
NP_783080 150 KTALVMNCNPFTLGHRYLIEHASKNSKEVIVFIVEEDKSLFPFKTRYNLVKEGTKDLKNVKIVPGGEYIISSATFPTYFI 229 Clostridium tetani...
YP_596743 147 VAAIVINANPFTLGHQFLVEKAARENDWVHLFMVSEDQSLVPFSVRKMLIQEGLRHLDNIIFHETGPYLISQATFPAYFQ 226 Streptococcus pyog...
NP_267344 144 IAAVVMNANPFTLGHCYLVEQAAAENDFVYVFVVSTDRSLFRADERLDLVKKGLSALTNVSVVSGGDYLVSFATFPAYFI 223 Lactococcus lactis...
NP_816917 146 aSSIVMNANPFTKGHQYLVEKAAQESPHVYVFVLSEDKSLFSKEARFAMVQKGVAHLPNVTVLSTEDYLVSSATFPTYFL 225 Enterococcus faeca...
O53076    136 VASVVINANPFTNGHRFLIEEASRNNELVYVFVLNQEASLFHTDERIALVKAGVQDLSNVIVVNGGAYIISYLTFPAYFL 215 Leuconostoc mesent...
YP_050665 237 KEEK--LITRAHAALDLIIFRKYIAPALGITQRFVGTEPFCPVTYQYNQDMhywlekDQTVSSPALNVVEIERKrQT--S 312 Pectobacterium atr...
NP_603226 224 KDEV--AVIESQANLDIEVFTK-IAKVLNINKRYVGEEPNSLVTNIYNQTM------VKKLPENNIECVVVPRK-KY--S 291 Fusobacterium nucl...
YP_193802 231 KSSD--DLIDVQTAIDASVFKNKIAPALNITRRYIGKEPISRTTHFYNVSL-------AHELGPDIEVIVVKRL-EK--D 298 Lactobacillus acid...
BAB83947  228 KDQA--SVIESQARIDLAIFIQ-IAKYLGIKGRYVGEEPTSLVTGIYNQIM------LQELPKKAIDCIVVPRK-TY--K 295 Streptococcus mutans
CAB60040  229 KNAD--DVIKYQTTLDARLFRDGIAKPLNITKRYVGTEPLSHTTAIYNETL-------QTELQPSVQLIEIDRK-QFe-M 297 Weissella paramese...
NP_783080 230 REED--ILVKAHAEIDAGIFGKYFGEKFNIKKRYVGEEPYCEVTNAYNQVL------KSTLPKFGIELEEIKRK-EI--Q 298 Clostridium tetani...
YP_596743 227 TEDN--DVIKSQALLDTAIFLK-IAQTLQITKRYVGEEPTSRVTAIYNEIM------AEQLQQAGILLDILPRK-AI--N 294 Streptococcus pyog...
NP_267344 224 QSDE--EVMDFQTQIDARIFKNWFVEALGITTRYLGAEPFSKTTSIYNQQL------T-EVLSDVIDVKIIERK-KAddN 293 Lactococcus lactis...
NP_816917 226 KEKAplEVAAIQATLDATLFKERIAPILEIQQRYVGEEPYSEVTAVYNQAM-------QQVFGQTITLTIVPRL-AS--D 295 Enterococcus faeca...
O53076    216 KHND--SAIDYQTTIDVRLFKYKIASALGITSRYVGSEPLSHTTNLYNQKL-------ISELNPQIEVHVIQRK-LA--A 283 Leuconostoc mesent...
YP_050665 313 GL--AISASEVRKLLKLRQYSRIQDIVPASTFEHL 345 Pectobacterium atrosepticum SCRI1043
NP_603226 292 DN--VISASTVRQIIKNGNLEDLKNLVPETTYNYF 324 Fusobacterium nucleatum subsp. nucleatum ATCC 25586
YP_193802 299 GE--IVTATKVRQLIKDGNLKEIDKFVPESTYLFI 331 Lactobacillus acidophilus NCFM
BAB83947  296 DG--PISASTVRKALKEGNEQILRELLPSTSLNYF 328 Streptococcus mutans
CAB60040  298 TH--VISATTVRSAIERGDEMLYQQLVPPTTKQFI 330 Weissella paramesenteroides
NP_783080 299 GD--FISASKVRGLIREGKLDEIINLVPSVTWEFL 331 Clostridium tetani E88
YP_596743 295 QQqdPISASTARQALKDNDWDLLAKLLPKTSLDYF 329 Streptococcus pyogenes MGAS9429
NP_267344 294 EE--IISATAVRAAIATNQLEKIRNFVPETTFEFI 326 Lactococcus lactis subsp. lactis Il1403
NP_816917 296 GE--LISATKVRKAMAEGDKETLKKFLPATSYQYL 328 Enterococcus faecalis V583
O53076    284 GDlgVISARTVREAIDKGDEAVWQKMVTETTQHFI 318 Leuconostoc mesenteroides subsp. cremoris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap