Conserved Protein Domain Family
Flu_M1_C

?
smart00759: Flu_M1_C 
Influenza Matrix protein (M1) C-terminal domain
This region is thought to be a second domain of the M1 matrix protein.
Statistics
?
PSSM-Id: 128998
View PSSM: smart00759
Aligned: 2 rows
Threshold Bit Score: 143.4
Threshold Setting Gi: 30349250
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAC31294 158 QHRSHRQMVTTTNPLIRHENRMVLASTTAKAMEQMAgsseQAAEAMEIASKARQMVQAMRTIGTHPSSSAGLKDDLLENL 237 Influenza A virus (...
AAP22121 158 SHRAHSRAARSSVPGVRREMQMVSAMNTAKTMNGMG----KGEDVQKLAEELQSNIGVLRSLGASQKSGEGIAKDVMEVL 233 Influenza B virus (...
AAC31294 238 QAYQKRMGVQMQRFK 252 Influenza A virus (A/eq/LaPlata/93(H3N8))
AAP22121 234 KQSSMGNSALVKKYL 248 Influenza B virus (B/Memphis/12/97-MA)
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap