2QKD,2QKD


Conserved Protein Domain Family
Zpr1

?
smart00709: Zpr1 
Click on image for an interactive view with Cn3D
Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Statistics
?
Aligned: 20 rows
Threshold Bit Score: 161.28
Threshold Setting Gi: 10639247
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QKD_A     13 SLCMNCYRNG--T--TRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSAT 88  house mouse
T43538    257 ATCPSCSHQC--D--THMKLLDIPHFKEVIIMSTVCDRCGYRSNEVKTGGEIPPKGRKITLKVMDAEDLSRDILKSETAS 332 fission yeast
O58960     31 GDCPICGGKG--TlkAIQFIHRIPYFGEVMESTVVCERCGYRNSDVIILEEREPR--LYEVKVEEEKDLFIRVVRSKSGT 106 Pyrococcus horikos...
Q57950      7 LDCPVCGGKG--TfvITSHQIDIPYFGPVLETTMICEKCNFRRSDVFPLEVREPK--KYILKIESERDLNKRVVRSSSAY 82  Methanocaldococcus...
NP_069617   2 IPCPSCGREL--R--AVVSTYDVPFFGKVLLTSISCE-CGFRHADSVVLGEKDPV--RYIIKINR-ENLFTKVIRSTSGT 73  Archaeoglobus fulg...
BAB09106  257 AIAQSNSTDI--S--DNLFRYSAP-EEEVIVMASTCDDCGYRNSELKPGGAIPEKGKKITLSVKNITDLSRDVIKSDTAG 331 thale cress
CAC11249    1 -----------------MYDTEIPYEGKISIYTYFCKECGYRKTEVYSDEKRDPK--KITIRIENPDDLRIIVYRSRRAD 61  Thermoplasma acido...
NP_503138 245 TDCPNCHGPT--E--VKMKPTDIPFFQTVIIMSLACDRCGYKSNEVKSGGAIRDQGCRMSVKLEKDLDLARDVLKTDTCA 320 nematode
NP_572532 259 TNCPSCQAPC--E--TNMKLTNIPHFKEVVIMATVCGACGHKTNEVKSGGGVEAQGVRFRVQIASREDLTRDVLKSETCS 334 fruit fly
NP_276940   8 IDCPVCGGERcmT--AVTRVEKIPYFGEIMESVLICERCNYRSTDIICLEQKEPS--RYIIEA-GADTLNARVVKSQSAT 82  Methanothermobacte...
2QKD_A     89 TRIPELDFEIPAFS-QKGALTTVEGLISRAISGLEQD-QPTRRAV-EGAIAERIDEFIGKLKDLK-QMASPFTLVIDDPS 164 house mouse
T43538    333 LKIPELGLDLFPGT-LGGRFTTIEGLLAQVYDELYARvFSQETDSmTPEQVANWQQFLCNLTAAR-EGATQFTLILDDPL 410 fission yeast
O58960    107 IELEELGIKIEPGPaAEGFVSNIEGVLERAKEVLLMArDFKEQEN-DREAVRRIDELLKYIEEVK-EGKKPLTVRIMDPF 184 Pyrococcus horikos...
Q57950     83 IQIPELGVEIKPGPlAEGFVSNVEGVLNRVDNILQTLiRWAETE----EQKKKAEELRERIKKLK-EGKEEATLILIDPL 157 Methanocaldococcus...
NP_069617  74 IRIPEIGVAIEPGPaSQAFITNLEGVLDRVEGVVRTAmRWNSDD---EEKVRRCEWILERIRNTI-DGDEELTLILEDPF 149 Archaeoglobus fulg...
BAB09106  332 VKIPELDLELAGGT-LGGMVTTVEGLVTQIRESLARVhGFTFGDSlEQSKINKWKEFGSRLTKLL-SLEQEWTLILDDEL 409 thale cress
CAC11249   62 VYIPEMEASIDSAEySNGEITTIEGIIYRIGEKLDLLaADDQNN-------KKIASLRKRIDGIInGKFESFTLIIMDES 134 Thermoplasma acido...
NP_503138 321 LSIPEIDLEVGGNA-LCGRFTTIEGLLTATKEQLDAQsSFFMGDSaQTGEKSAVTTFLEKLDDII-ALRLPATIILDDPT 398 nematode
NP_572532 335 MSIPELDLEVGPHA-LCGRFTTVEGLLVAMRDQLDG--TLFHDSA-DDATKQQMQRFLDTFEDVM-NLKRVITLVLEDPA 409 fruit fly
NP_276940  83 IRIPELGLKVEPGPrSAGYISNIEGVVERFEAALKTAlNLFEDD----ESKKKASKILEMLHEVR-EGVRKVTVIIEDPF 157 Methanothermobacte...
2QKD_A    165 GNSFVEN 171 house mouse
T43538    411 SQSYLQN 417 fission yeast
O58960    185 GNSALIG 191 Pyrococcus horikoshii OT3
Q57950    158 GHSAIIG 164 Methanocaldococcus jannaschii DSM 2661
NP_069617 150 GNSLIVS 156 Archaeoglobus fulgidus DSM 4304
BAB09106  410 ANSFISP 416 thale cress
CAC11249  135 GKSVVHS 141 Thermoplasma acidophilum
NP_503138 399 GCSYVQS 405 nematode
NP_572532 410 GNTYVQS 416 fruit fly
NP_276940 158 GQSFVGH 164 Methanothermobacter thermautotrophicus str. Delta H
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap