2QKD,2QKD


Conserved Protein Domain Family
Zpr1

?
smart00709: Zpr1 
Click on image for an interactive view with Cn3D
Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Statistics
?
PSSM-Id: 128949
View PSSM: smart00709
Aligned: 20 rows
Threshold Bit Score: 161.28
Threshold Setting Gi: 10639247
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QKD_A       13 SLCMNCYRNG--T--TRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSAT 88
gi 11278733 257 ATCPSCSHQC--D--THMKLLDIPHFKEVIIMSTVCDRCGYRSNEVKTGGEIPPKGRKITLKVMDAEDLSRDILKSETAS 332
gi 6136596   31 GDCPICGGKG--TlkAIQFIHRIPYFGEVMESTVVCERCGYRNSDVIILEEREPR--LYEVKVEEEKDLFIRVVRSKSGT 106
gi 2496025    7 LDCPVCGGKG--TfvITSHQIDIPYFGPVLETTMICEKCNFRRSDVFPLEVREPK--KYILKIESERDLNKRVVRSSSAY 82
gi 11498389   2 IPCPSCGREL--R--AVVSTYDVPFFGKVLLTSISCE-CGFRHADSVVLGEKDPV--RYIIKINR-ENLFTKVIRSTSGT 73
gi 9758720  257 AIAQSNSTDI--S--DNLFRYSAP-EEEVIVMASTCDDCGYRNSELKPGGAIPEKGKKITLSVKNITDLSRDVIKSDTAG 331
gi 10639247   1 -----------------MYDTEIPYEGKISIYTYFCKECGYRKTEVYSDEKRDPK--KITIRIENPDDLRIIVYRSRRAD 61
gi 17565020 245 TDCPNCHGPT--E--VKMKPTDIPFFQTVIIMSLACDRCGYKSNEVKSGGAIRDQGCRMSVKLEKDLDLARDVLKTDTCA 320
gi 18858239 259 TNCPSCQAPC--E--TNMKLTNIPHFKEVVIMATVCGACGHKTNEVKSGGGVEAQGVRFRVQIASREDLTRDVLKSETCS 334
gi 15679822   8 IDCPVCGGERcmT--AVTRVEKIPYFGEIMESVLICERCNYRSTDIICLEQKEPS--RYIIEA-GADTLNARVVKSQSAT 82
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2QKD_A       89 TRIPELDFEIPAFS-QKGALTTVEGLISRAISGLEQD-QPTRRAV-EGAIAERIDEFIGKLKDLK-QMASPFTLVIDDPS 164
gi 11278733 333 LKIPELGLDLFPGT-LGGRFTTIEGLLAQVYDELYARvFSQETDSmTPEQVANWQQFLCNLTAAR-EGATQFTLILDDPL 410
gi 6136596  107 IELEELGIKIEPGPaAEGFVSNIEGVLERAKEVLLMArDFKEQEN-DREAVRRIDELLKYIEEVK-EGKKPLTVRIMDPF 184
gi 2496025   83 IQIPELGVEIKPGPlAEGFVSNVEGVLNRVDNILQTLiRWAETE----EQKKKAEELRERIKKLK-EGKEEATLILIDPL 157
gi 11498389  74 IRIPEIGVAIEPGPaSQAFITNLEGVLDRVEGVVRTAmRWNSDD---EEKVRRCEWILERIRNTI-DGDEELTLILEDPF 149
gi 9758720  332 VKIPELDLELAGGT-LGGMVTTVEGLVTQIRESLARVhGFTFGDSlEQSKINKWKEFGSRLTKLL-SLEQEWTLILDDEL 409
gi 10639247  62 VYIPEMEASIDSAEySNGEITTIEGIIYRIGEKLDLLaADDQNN-------KKIASLRKRIDGIInGKFESFTLIIMDES 134
gi 17565020 321 LSIPEIDLEVGGNA-LCGRFTTIEGLLTATKEQLDAQsSFFMGDSaQTGEKSAVTTFLEKLDDII-ALRLPATIILDDPT 398
gi 18858239 335 MSIPELDLEVGPHA-LCGRFTTVEGLLVAMRDQLDG--TLFHDSA-DDATKQQMQRFLDTFEDVM-NLKRVITLVLEDPA 409
gi 15679822  83 IRIPELGLKVEPGPrSAGYISNIEGVVERFEAALKTAlNLFEDD----ESKKKASKILEMLHEVR-EGVRKVTVIIEDPF 157

                ....*..
2QKD_A      165 GNSFVEN 171
gi 11278733 411 SQSYLQN 417
gi 6136596  185 GNSALIG 191
gi 2496025  158 GHSAIIG 164
gi 11498389 150 GNSLIVS 156
gi 9758720  410 ANSFISP 416
gi 10639247 135 GKSVVHS 141
gi 17565020 399 GCSYVQS 405
gi 18858239 410 GNTYVQS 416
gi 15679822 158 GQSFVGH 164
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap