Conserved Protein Domain Family
DM13

?
smart00686: DM13 
Domain present in fly proteins (CG14681, CG12492, CG6217), worm H06A10.1 and Arabidopsis thaliana MBG8.9.
Statistics
?
PSSM-Id: 128929
View PSSM: smart00686
Aligned: 9 rows
Threshold Bit Score: 128.629
Threshold Setting Gi: 15239759
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
NP_510255    157 FGEYGIISDPIEVIDSRTLKIPKFSYKaSQTPDGYFFAGAGSEIDQKs--GKKaailRS--DQTLn--YCPMLKDIT--D 228 nematode
NP_001097889 211 RLAHGLRSSNISVLDAKTFYIPNLHYD-GAGPDAYFWVGNGSEPNIM---GIK----VP--NESG---SLEPLRGYQ--G 275 fruit fly
NP_001027171 158 RGVHGVSSDNIVIVDAQTLLVPNFSYD-GEAPDAKFWVGRGQRPTSD---GLR----IP--DENG---KENPLRRYE--R 222 fruit fly
NP_001027171  42 RLHHGVSGD-VYAVDSRTIFIKKFNYD-GEAPAAYFYVGNTARPSNEg--AAR----LR--DERGg--TASLTRRYR--N 107 fruit fly
XP_002104014 166 KRSHNVSSSSVEILDSKTIRIKDFTYD-GRGKRTFFWTGVGPQPSSR---GSK----LP--DERG---YLDPIRQYN--K 230 Drosophila simu...
XP_002031777  51 SYHHQVSGD-VYAVNEYTFLIVGFNYD-GNGADTFFWSGASNRPGPQ---GFI----VP--DEYG---KTNILDRYH--N 114 Drosophila sech...
T26047        38 SSPETDISGQVFIVNATTLQIFNLTFS-PSQQDLYFWLDTKDVPTREg--IKA----HT--FEYG----ITPLGSFPedN 104 nematode
NP_509769    736 SLQFNISSGPIEILDVKTIRINDFSFQ-H-DDDSVWLMVGSELLPNLn--GKI----VPlfDENTrkfDCQGLMSYH--G 805 nematode
NP_200294     42 MLQHQLRGV-FTVVDDCSFRVSRFDML--SGSEVHWWGAMSSDFDNMtndGFV----IS--DQK-------LNQTFK--N 103 thale cress
NP_510255    229 QDIIIRLDQSQTIYDIEWISVFCYKYSHDFGHLDMGLVENEE 270 nematode
NP_001097889 276 EDIEIQLPESLTVYDIDWLAVWCVEYRHNFGHVYIPRDLDVP 317 fruit fly
NP_001027171 223 KTIVLTLPEDLTIFDIGHFGVWCEAFTVDFGHVRLPEGLNVP 264 fruit fly
NP_001027171 108 KDVTLSLPEGKTLRDIKWFSVWCDEFAVNFGDVSIPPNLDFP 149 fruit fly
XP_002104014 231 ETIELELPGDKTIFDIDWISVYDVADNENYGHVLFNDKLNVP 272 Drosophila simulans
XP_002031777 115 KDFTLTLPDRKKITEIKWLAVYDLSSQNNFGDVYIPEEFDPP 156 Drosophila sechellia
T26047       105 DRVVVHVPEKHRIDEFKSFSIYSFKTDKSMASVVFPENVKIP 146 nematode
NP_509769    806 ETIVFRLPGELTWKDVFWFSSHLC-LILNGDSFLFLKKFKIS 846 nematode
NP_200294    104 SSFIVRLLGNVTWDKLGVVSVWDLPTASDFGHVLLSNATESD 145 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap