Conserved Protein Domain Family
DM16

?
smart00683: DM16 
Repeats in sea squirt COS41.4, worm R01H10.6, fly CG1126 etc.
Statistics
?
PSSM-Id: 128926
View PSSM: smart00683
Aligned: 10 rows
Threshold Bit Score: 86.1484
Threshold Setting Gi: 17554440
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAF98137      41 EILLSKLSPVEDTKGNNGEEGVLYVTNLRCMWQSKANPHKNLSVGYYGIQGIEVR 95  Trypanosoma cruzi
AAF98137     170 EQLFTRLEGVTNVSEDKGIIGVFFTTNVRIVWFAQHAPHINISVPILQLTALRMR 224 Trypanosoma cruzi
CAB06048     155 EEIYNRINGVWNLSSNQGNLGTFFVTNIRVVWHANMNESFNVSVPYLQIQTVKVR 209 Ciona intestinalis
CAB06048      25 EFVIQTFNSVEDTKGNNGDNGKLLVTNLRVMWHSHTLPRVNLSIGFGCIHNITTR 79  Ciona intestinalis
CBH09104      41 ERILMRLSPVEDTKGNSGKEGVLYVTNLRFMWHSSHRVRNNLSVGYYGVYNMSVQ 95  Trypanosoma brucei gambiense DAL972
CBH09104     171 ERLVTRVKGVSNVSSEQGHIGTFFTTNLRLLWCSDTSAEFNISIPFLQIAAMRIQ 225 Trypanosoma brucei gambiense DAL972
AAY55771     146 EEVFSHVQGVWNLSSDQGNLGSFVVTNIRLVWFADANETFNISLPYLQIESLRVR 200 fruit fly
XP_002038341  40 ERVLDYIYHIEDSKGNPGDTGRLMVTNLRIIWHSLVHKKYNLSIGYARIGNTNTR 94  Drosophila sechellia
NP_499272     30 EIQVAKIEHVEDTKGNNGDRGTMRVTNLRLIWHAASMPRINITIGWNAITGVQSK 84  nematode
NP_499272    168 ETIIEKVNGVWNLSTETGSLGVFVITNIRVVWYAEMNIGYNVSVPYITLYSVRVR 222 nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap