Conserved Protein Domain Family
CTNS

?
smart00679: CTNS 
Repeated motif present between transmembrane helices in cystinosin, yeast ERS1p, mannose-P-dolichol utilization defect 1, and other hypothetical proteins.
Function unknown, but likely to be associated with the glycosylation machinery.
Statistics
?
PSSM-Id: 128923
View PSSM: smart00679
Aligned: 33 rows
Threshold Bit Score: 32.0391
Threshold Setting Gi: 74676342
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9VCR7       145 VSFYPQIWSNYRRKSVE-GLNFDFLALNIVGFT 176 fruit fly
Q06328        25 ISLFPQIIETYRDKSVD-GLSPYFLLAWLCGDI 56  Saccharomyces cerevisiae S288c
O49437        20 VAEIPQIMTNYNQKSIE-GVSITFLTTWMLGDI 51  thale cress
O23198        47 VAEIPQVITNFRTKSSN-GVSLSFLLAWVAGDI 78  thale cress
Q03193       144 VGLLPPYFELAKRKGRViGINFAFLFIDSLGAW 176 Saccharomyces cerevisiae S288c
NP_593250     38 ISYLLQIFRIVRLGSSQ-GLSFSYLILGYIGVL 69  Schizosaccharomyces pombe 972h-
NP_200755     44 TVKLPQIMKIVDNKSVK-GLSVVAFELEVIGYT 75  thale cress
NP_505155     47 LLFVPQILKIQAARSAQ-GISAASQLLALVGAI 78  nematode
NP_594847    155 IGFLPQYISIFRARAVT-GISYLFLAIDSSGSL 186 Schizosaccharomyces pombe 972h-
XP_001092522  90 ASTFPQFIKAYKTGNMDqALSLWFLLGWIGGDS 122 rhesus monkey
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap