Conserved Protein Domain Family
DM11

?
smart00675: DM11 
Domains in hypothetical proteins in Drosophila including 2 in CG15241 and CG9329.
Statistics
?
PSSM-Id: 128920
View PSSM: smart00675
Aligned: 8 rows
Threshold Bit Score: 221.563
Threshold Setting Gi: 24642685
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ACM90877      16 ADYELLLEDPDIFSPCTEPP-PGSIGFHDAF-DIGDLVVDQ--DMDIIHLSESVTSIW-DVEPTDRISARFAIMHYNRGS 90  fruit fly
NP_995763     17 TDYELLLEDPDIFSTCTDGP-PGSINIRQAL-NLDDIVIDQ--KGDILHVSGNATVVW-DVQPTDRITARLDVFHFNRGT 91  fruit fly
NP_995736     18 TDYTLEFEDSDLYSECSEKL-PGAIGLREAF-DMRNIVTEL--DIDGLHLSGNCTTIW-DVPSTDRISLRMTVMHFDRGT 92  fruit fly
ACS78063      20 TDYNALIDDEGIYVKCSEAP-AGTLGPRDVF-NIDNMVMHM--EPEGIYVSGNMTVKL-NFLPSDRISARFSVMHYERGS 94  fruit fly
NP_650970     24 MSHDFVPIKDDLLSKCEDK--PEMGYLDAFV-DLSNFSRKR--GPGGVNISGNITTIW-DVDPSDVVEIDVSILKFEGDK 97  fruit fly
NP_995765     20 TEYQLTLDKDGLLAPCENQ--PGNPSGFEAMvDTSSLKVHN--LGSKVRIEGEQKVVWkDVQPGDTLKVFGQVYRLDKGT 95  fruit fly
NP_001163025  18 TDYILLVEDPDIYTPCTDGP-PGSVGLNEAF-D-----------------------------------ARMSVLHFNRGN 60  fruit fly
NP_573178     41 TTYEILGDDRILDIVCDAAEdRGNTPIRQIL-DISGLTVDMaaDLETLYFNGDIKVLI-DV-PNNPMAMEVDVFRWERSE 117 fruit fly
ACM90877      91 WEPTVFSMATPDFCASMFDENQSWFKYWTKHISNRDEVMEKCFKTRGTVIMHNPFDLQLRLTDIRGATLRGRYKAVVTFE 170 fruit fly
NP_995763     92 WEPTVFSMATQNFCSIMYDKNQYWYKYWTRFITNRHEVEKKCFRGPDTVLVHEPFDLILKFENFRGPLLRGRHKLVILFN 171 fruit fly
NP_995736     93 WQPTVFNTYARDFCAVMFDKELSWYKYWLKYFANREEISEKCIGTKGTVLVYKPFIVKPLIQNVIGPIYRGRVKAIFNFE 172 fruit fly
ACS78063      95 WQPTMFNLHSPNFCEVMFDEDQYWFKYWFRYIRNKEEIREKCLKVKDTVLVYDEFLMVLHLENVNTSNLQGRYKAVITLE 174 fruit fly
NP_650970     98 WIPTIIKGNVKDFCKSFYDKNTLYYSYSTKHVVNKKEAKEKCITTPGAILLWEPYLLKISFS-YAVPLNVGRHKAVLIFT 176 fruit fly
NP_995765     96 WQKTMFTASSNNFCKNMFDKNQYWYNFWTKYISNSDEIKEKCLTTPGAVLKYKDYELDLKTS-LNVPNLDGRYKLVVQIE 174 fruit fly
NP_001163025  61 WEPTVFNTLTPDFCDAMFNPNLFWYKYWFKNFENREEIQEKCLATQGTVLVYNPFVVVPRLNNVLGPTLKGRYKVVFLFE 140 fruit fly
NP_573178    118 WIPTTLAMKRDSFCMSLSNPMELWYPIFLKVP--KEE--MICPPKKGHVYRLANVSNHVFVRNMPYANIAGDAKAVVHLT 193 fruit fly
ACM90877     171 AVDEKDVPR 179 fruit fly
NP_995763    172 ALDERNIPR 180 fruit fly
NP_995736    173 SFDKNNVKG 181 fruit fly
ACS78063     175 AFDEHNVRR 183 fruit fly
NP_650970    177 AIDKAGVKR 185 fruit fly
NP_995765    175 AFDKRNVRR 183 fruit fly
NP_001163025 141 AFNEQDERQ 149 fruit fly
NP_573178    194 SGDIKTCAV 202 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap