Conserved Protein Domain Family
CTLH

?
smart00668: CTLH 
C-terminal to LisH motif.
Alpha-helical motif of unknown function.
Statistics
?
PSSM-Id: 128914
View PSSM: smart00668
Aligned: 54 rows
Threshold Bit Score: 31.0022
Threshold Setting Gi: 19115557
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O22730             78 TITDRMAVKKAVQNGNVEDAIEKVNDLNPEILDTNPELFFHLQQQRLIELIRQGKTEE 135  thale cress
O94967             45 FSDDMLFLRQLILDGQWDEVLQFIQPLECMEKFDKKRFRYIILKQKFLEALCVNNAMS 102  human
Q9VE18             40 TVDSVDGFVQDISNGHWDTVLKVTQSLKLPD-----KKLLNLYEQIVLELIELRELGA 92   fruit fly
Q9NVD1             40 TVDSIESFVADINSGHWDTVLQAIQSLKLPD-----KTLIDLYEQVVLELIELRELGA 92   human
FlyBase:CG8811-PA 240 HPLISELHKCLVLQGDFEKAERFIVECIDEG-----LMDEYLHKQDYKHSWHMKHTES 292  fruit fly
O62120             41 TVDSIDGFCNEITSGNWDNVLKTVQSLKLPA-----KKLIDLYEHVIIELVELRELAT 93   Caenorhabditis elegans
NP_001042893       45 TVDSIDTFIADINAGRWDAVLPQVAQLKLPR-----KKLEDLYEQIVLEMAELRELDT 97   Japanese rice
AAG52064           51 TVDSVETFISDINSGRWDSVLPQVSQLKLPR-----NKLEDLYEQIVLEMIELRELDT 103  thale cress
NP_491864          62 FSDDLLFLRQLILDGQWDNALDFVEPLKPVNEFDFGAFRYNITKYKFFELLCVKLEPG 119  nematode
NP_196473          97 HNSTIKLFLQQVKDGKWDQSVKTLHRIGFPDEKAVKAASFLLLEQKFLEFLKVEKIAD 154  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap