Conserved Protein Domain Family
LisH

?
smart00667: LisH 
Lissencephaly type-1-like homology motif
Alpha-helical motif present in Lis1, treacle, Nopp140, some katanin p60 subunits, muskelin, tonneau, LEUNIG and numerous WD40 repeat-containing proteins. It is suggested that LisH motifs contribute to the regulation of microtubule dynamics, either by mediating dimerisation, or else by binding cytoplasmic dynein heavy chain or microtubules directly.
Statistics
?
PSSM-Id: 128913
View PSSM: smart00667
Aligned: 121 rows
Threshold Bit Score: 29.3248
Threshold Setting Gi: 5901954
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAB26074   24 VQRADMNRLIMNYLVTEGFKEAAEKFRMESGIEP 57   house mouse
T39361     37 TTQSLLNSYIYDYLIKKDYCEAARAFGREAQVQT 70   fission yeast
T41011     33 HPNESLDYYIYDYFVKHNFEEAAQAFLRESKIQI 66   fission yeast
NP_011632   6 TSRFYTNLLIANYLKHNGLEDTLAAFIRETALPL 39   Saccharomyces cerevisiae S288c
T00798      7 EADKMLDVYIYDYLVKKKLHNTAKSFMTEGKVSP 40   thale cress
AAG32022    7 EADKMLDVYIHDYLVKRDLKATAQAFQAEGKVSS 40   thale cress
BAB17072   51 EAEKMLDVYIHDYLLKRNLQSTAKAFQAEGSVSS 84   Oryza sativa (japonica cultivar-group)
T08588     14 FECNRLDVYIHDYLVKRDLKATAQAFQAEGKVSS 47   thale cress
BAA12076    2 NCKNTLNEYIFDFLTKSSLKNTAAAFAQDAHLDR 35   baker's yeast
NP_011287 709 SLPNTLNVMINDYLIHEGLVDVAKGFLKDLQKDA 742  Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap