1G61,1G62


Conserved Protein Domain Family
eIF6

?
smart00654: eIF6 
Click on image for an interactive view with Cn3D
translation initiation factor 6
Statistics
?
Aligned: 20 rows
Threshold Bit Score: 224.455
Threshold Setting Gi: 74499465
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1G61_A         5 IRKYFSGIPTIGVLALTTEEITLLPIFLDKDDVNEVSEVLE--T---KCLQTNIGGSSLVGSLSVANKYGLLLPKIVEDE 79  Methanocaldococ...
Q9HM16         3 rktsvlrsnfigiyakawddvafitMMADEKTVADFQEVLQ--V---DVRRISIDNSSLIGTMMVMNSNGLIVP---YGS 74  Thermoplasma ac...
Q9P9D7         4 DTLDIHGSDQIGIHLASVGNVLFHPRELPTPTIEKLEQVVG--L---ELAPISIGGSNLIGALLAGNTKGMAVADIATES 78  uncultured mari...
NP_493272      3 LRVDYEGSNDVGVFCTLTNSYCLVGVGGTQNFYSILEAELSdlI---PVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQ 79  nematode
XP_001713624   3 IKLNLYGKEDIGNYILLTNSYCIVPHDINSKNYNIIKSELDnkI---NIICTNVSESICVGNLLIGNSKGLIVPNTITFH 79  Guillardia theta
NP_147705     10 EKLSLYGNPNIGVYLTASDSYVLAPDDIGADDVRTISEVLG--VameRVVRLRVLGMRLVGVLTTGNSRGILLPEGV-DR 86  Aeropyrum perni...
YP_256079      4 DKLSIFGTDNIGIYIFTNDKYTIIPKIDDKEVIEKIQGILK--T---EIIQTTISKSVLVGILVTGNNDVILLPRTALAD 78  Sulfolobus acid...
NP_341891      4 QRLSVFGTDNIGVYIYTNNKYTIIPRGLDSETKENIAQVLG--T---ELLEAEISRSFLLGIFISGNDNGILLPKSTIDD 78  Sulfolobus solf...
NP_276723      3 RRINLSGNPNLGVYISVTDSVALIPQNTPEKFEGVLREALE--V---EVLKVSISGSSLNGALAVGNSNGFVVSNQAMDR 77  Methanothermoba...
NP_070889      1 MKVAVNGNPLIGLYAKVSEEYAVVGVN-HEPLIDAIQEKLD--V---DVIVTKIAGSELVGAMMALNSRGAVVSDQVLSS 74  Archaeoglobus f...
1G61_A        80 ELDRIKNFLKENnldLNVEIIKS---K--NTALGNLILTNDKGALISPEL-KDFKKDIEDSLNVE-V-EIGTIAELPTVG 151 Methanocaldococ...
Q9HM16        75 EITGLG-DLDGR------NVLQL---KdkINAIGNDIIANDHGAIIHKNFsNRSRKEIEDTLGVE-T-IRTTIGNILTVG 142 Thermoplasma ac...
Q9P9D7        79 DID----ALTAY---GDVVVMEG---Gv-NTA-GNLLLVNEQGCVASPSIpKDGLDILSEVLGVD-I-ISTTIGGQDVVG 144 uncultured mari...
NP_493272     80 ELQHLRNSLPDE---VAIRRVDE---R--LSALGNVIACNDHVAIVHAEIsAETEQALVEVLKVE-V-FRVSLAQNSLVG 149 nematode
XP_001713624  80 EQNELLNFLPEK---VLVKKFNE---N--LTNLGNLLAHNELYGLSSPDLsQSSCELISDVLGVE-I-LKLTLGEEKMIG 149 Guillardia theta
NP_147705     87 EVELVRKALEG----VEVGIVPT---R--SNALGNVIVCNDRACLASPGLeKEALKTVSDTLGVE-V-VEGSVAGVYTVG 155 Aeropyrum perni...
YP_256079     79 EIKVIK-EQAKD---VRVEVVDI---R--PTALGNIILSNTHGALIYQDLsEAEINKVKKALQID-TaIKGTIANIITVG 148 Sulfolobus acid...
NP_341891     79 EFR----FLKEN---LRDCRVEIlnsK--VTALGNTILANNKAALIYPEFnDIEEKIIKETLGVEdI-KRGKIAQMITVG 148 Sulfolobus solf...
NP_276723     78 EIDALA---AAG---VEAVRIPE---R--FTAVGNLVLANDNGAVASPLLsDDALQVIGDVLEVD-V-KVSTLAGLNIVG 144 Methanothermoba...
NP_070889     75 ELR----ELEKS---LDVLVIET---P--MTCFGNNLLINDRGGIANPEMeSSVVEKVADFMDIE-L-VKGTVGGIKTVG 140 Archaeoglobus f...
1G61_A       152 SNAVVTNKGCLTHPLVEDDELEFLKSLFKVEYIGkGTANKGTTSVGACIIANSKGA 207 Methanocaldococcus jannaschii
Q9HM16       143 SAGILTSKGMLVNPETDDDELEFLRDFFKVSVKS-GTANFGSIYVGASIVANSKGV 197 Thermoplasma acidophilum DSM 1728
Q9P9D7       145 SLGVVNSQGVLLHPDVAPEEVLLIEEILGVPPMV-GTVSFGSPYVGAGICASNNGA 199 uncultured marine group II euryarchaeot...
NP_493272    150 SYCILSSNGCLVAARTPPETQREIAALLQIPVVA-GTCNRGSELIGAGMVVNDWVA 204 nematode
XP_001713624 150 TYCKFNINGGIVQPFLSIEDHDELVEITGVPFIG-GTVNSGCSNVGKGIVCNDNLV 204 Guillardia theta
NP_147705    156 SAIVVTNRGGLAHPDASEEELKFLSDVFKVPFEA-GTINFGVEFVRTGLVANSYGA 210 Aeropyrum pernix K1
YP_256079    149 SVAVITDKAGLVHIDATEEELKKLSELFKVKLDS-GTVNFGSVFIRSGLVANRNGV 203 Sulfolobus acidocaldarius DSM 639
NP_341891    149 SVGVITNKGGLVHVDTSEKELKELEKLFGVKIDI-GTVNFGSVFIKSGLVANDKGT 203 Sulfolobus solfataricus P2
NP_276723    145 SMGAATNRGALLNPQASSEEIGIIEDTLGVEADV-GTVNHGVTLIGACSVANSNGV 199 Methanothermobacter thermautotrophicus ...
NP_070889    141 MAAVVTNRGGLANPNINEWEAKKLQEVAGVEVLT-GTVNFGTDMVGSGLVANSKGY 195 Archaeoglobus fulgidus DSM 4304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap