1G61,1G62


Conserved Protein Domain Family
eIF6

?
smart00654: eIF6 
Click on image for an interactive view with Cn3D
translation initiation factor 6
Statistics
?
PSSM-Id: 128902
View PSSM: smart00654
Aligned: 20 rows
Threshold Bit Score: 224.455
Threshold Setting Gi: 74499465
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G61_A         5 IRKYFSGIPTIGVLALTTEEITLLPIFLDKDDVNEVSEVLE--T---KCLQTNIGGSSLVGSLSVANKYGLLLPKIVEDE 79
gi 20138519    3 rktsvlrsnfigiyakawddvafitMMADEKTVADFQEVLQ--V---DVRRISIDNSSLIGTMMVMNSNGLIVP---YGS 74
gi 74499465    4 DTLDIHGSDQIGIHLASVGNVLFHPRELPTPTIEKLEQVVG--L---ELAPISIGGSNLIGALLAGNTKGMAVADIATES 78
gi 17506075    3 LRVDYEGSNDVGVFCTLTNSYCLVGVGGTQNFYSILEAELSdlI---PVVHTSIASTRIVGRLTVGNRHGLLVPNATTDQ 79
gi 162606218   3 IKLNLYGKEDIGNYILLTNSYCIVPHDINSKNYNIIKSELDnkI---NIICTNVSESICVGNLLIGNSKGLIVPNTITFH 79
gi 14601175   10 EKLSLYGNPNIGVYLTASDSYVLAPDDIGADDVRTISEVLG--VameRVVRLRVLGMRLVGVLTTGNSRGILLPEGV-DR 86
gi 70607209    4 DKLSIFGTDNIGIYIFTNDKYTIIPKIDDKEVIEKIQGILK--T---EIIQTTISKSVLVGILVTGNNDVILLPRTALAD 78
gi 15897286    4 QRLSVFGTDNIGVYIYTNNKYTIIPRGLDSETKENIAQVLG--T---ELLEAEISRSFLLGIFISGNDNGILLPKSTIDD 78
gi 15679606    3 RRINLSGNPNLGVYISVTDSVALIPQNTPEKFEGVLREALE--V---EVLKVSISGSSLNGALAVGNSNGFVVSNQAMDR 77
gi 11499647    1 MKVAVNGNPLIGLYAKVSEEYAVVGVN-HEPLIDAIQEKLD--V---DVIVTKIAGSELVGAMMALNSRGAVVSDQVLSS 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1G61_A        80 ELDRIKNFLKENnldLNVEIIKS---K--NTALGNLILTNDKGALISPEL-KDFKKDIEDSLNVE-V-EIGTIAELPTVG 151
gi 20138519   75 EITGLG-DLDGR------NVLQL---KdkINAIGNDIIANDHGAIIHKNFsNRSRKEIEDTLGVE-T-IRTTIGNILTVG 142
gi 74499465   79 DID----ALTAY---GDVVVMEG---Gv-NTA-GNLLLVNEQGCVASPSIpKDGLDILSEVLGVD-I-ISTTIGGQDVVG 144
gi 17506075   80 ELQHLRNSLPDE---VAIRRVDE---R--LSALGNVIACNDHVAIVHAEIsAETEQALVEVLKVE-V-FRVSLAQNSLVG 149
gi 162606218  80 EQNELLNFLPEK---VLVKKFNE---N--LTNLGNLLAHNELYGLSSPDLsQSSCELISDVLGVE-I-LKLTLGEEKMIG 149
gi 14601175   87 EVELVRKALEG----VEVGIVPT---R--SNALGNVIVCNDRACLASPGLeKEALKTVSDTLGVE-V-VEGSVAGVYTVG 155
gi 70607209   79 EIKVIK-EQAKD---VRVEVVDI---R--PTALGNIILSNTHGALIYQDLsEAEINKVKKALQID-TaIKGTIANIITVG 148
gi 15897286   79 EFR----FLKEN---LRDCRVEIlnsK--VTALGNTILANNKAALIYPEFnDIEEKIIKETLGVEdI-KRGKIAQMITVG 148
gi 15679606   78 EIDALA---AAG---VEAVRIPE---R--FTAVGNLVLANDNGAVASPLLsDDALQVIGDVLEVD-V-KVSTLAGLNIVG 144
gi 11499647   75 ELR----ELEKS---LDVLVIET---P--MTCFGNNLLINDRGGIANPEMeSSVVEKVADFMDIE-L-VKGTVGGIKTVG 140
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....*.
1G61_A       152 SNAVVTNKGCLTHPLVEDDELEFLKSLFKVEYIGkGTANKGTTSVGACIIANSKGA 207
gi 20138519  143 SAGILTSKGMLVNPETDDDELEFLRDFFKVSVKS-GTANFGSIYVGASIVANSKGV 197
gi 74499465  145 SLGVVNSQGVLLHPDVAPEEVLLIEEILGVPPMV-GTVSFGSPYVGAGICASNNGA 199
gi 17506075  150 SYCILSSNGCLVAARTPPETQREIAALLQIPVVA-GTCNRGSELIGAGMVVNDWVA 204
gi 162606218 150 TYCKFNINGGIVQPFLSIEDHDELVEITGVPFIG-GTVNSGCSNVGKGIVCNDNLV 204
gi 14601175  156 SAIVVTNRGGLAHPDASEEELKFLSDVFKVPFEA-GTINFGVEFVRTGLVANSYGA 210
gi 70607209  149 SVAVITDKAGLVHIDATEEELKKLSELFKVKLDS-GTVNFGSVFIRSGLVANRNGV 203
gi 15897286  149 SVGVITNKGGLVHVDTSEKELKELEKLFGVKIDI-GTVNFGSVFIKSGLVANDKGT 203
gi 15679606  145 SMGAATNRGALLNPQASSEEIGIIEDTLGVEADV-GTVNHGVTLIGACSVANSNGV 199
gi 11499647  141 MAAVVTNRGGLANPNINEWEAKKLQEVAGVEVLT-GTVNFGTDMVGSGLVANSKGY 195
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap