1JFX,1OBA


Conserved Protein Domain Family
Glyco_25

?
smart00641: Glyco_25 
Click on image for an interactive view with Cn3D
Glycosyl hydrolases family 25
Statistics
?
PSSM-Id: 128889
View PSSM: smart00641
Aligned: 20 rows
Threshold Bit Score: 79.7699
Threshold Setting Gi: 15893844
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JFX_A      5 VQGIDVSHWQGS----INWSSVKSAGM--SFAYIKATEGTNYKDDRFSANYTNAYNAG---IIRGAYH----FARPN-AS 70  Streptomyces coeli...
Q38359     91 QKRIVWLDWESGsgntVTGSKASNTSA--ILAFMDAIKAAGWRPGLYSGASLLRTAIDtaqVVKKYGTclwvASYPT-MA 167 Lactobacillus phag...
Q9L922    234 KVSYLVIDYEDS----ASADKEANTKA--VIAFMDKIANAGYKPVYYSYKPFTLNNIDyqqIIAKYPNsiwiAGYPD-YE 306 Streptococcus equi
Q37969    115 KNSIVALDYEGG----ASGNKQANTDA--ILYGMRRVKAAGYTPMYYSYKPYTLANVNykqIIKEFPKslwiAAYPN-YE 187 Lactococcus phage ...
Q9ZXH8    115 KGSIVALDVE-------SGN--PNTAS--VEYALAKIKAAGYTPVLYGYKSFLTAHLDlasIAKTYPlw--lAEYPN-YN 180 Oenococcus phage f...
Q9ZEK6      1 MNGIDISSYQ---------AELNAGIVpsDFVIIKATEGTNYINPTWEEQAGQVIQTN---KLLGFYH----FASVG-N- 62  Lactococcus lactis
NP_958600  94 pGSYLACDYEQGsgneTGGNREENTTA--ILAFLNTIVSAGYKPLLYSGAELMKNKVNtakILAKYPNclwvAAYPYkGA 171 Lactobacillus prop...
P19385     85 QVKYLVLDYEDH----ASASVQRNTTA--CLRFMQMIAEAGYTPIYYSYKPFTLDNVDyqqILAQFPNslwiAGYGL-ND 157 Streptococcus phag...
P33486      4 TYGVDVAVYQP-----IDLAAYHKAGA--SFAIVKLTEGVDYVNRRGPSRWTAPGLTTstlMPTISRS----FGSSV-S- 70  Lactobacillus phag...
1OBA_A     85 QVKYLVLDYEDD----PSGDAQANTNA--CLRFMQMIADAGYKPIYYSYKPFTHDNVDyqqILAQFPNslwiAGYGL-ND 157 Streptococcus phag...
1JFX_A     71 -SGTAQADYFASNGGGWSRDNRTLPGVLDIEHN-PSGAMCYGL 111 Streptomyces coelicolor
Q38359    168 aVSSADFRYFPSMDGVAIWQFTSNWKGLGVDGNlALVDLNSDA 210 Lactobacillus phage LL-H
Q9L922    307 vRTEPLWEFFPSMDGVRWWQFTSVGVAGGLDKNiVL--LADDS 347 Streptococcus equi
Q37969    188 vTPVPNYSFFPSMDGISVFQFTSTYVAGGLDGNvDLTGITGNG 230 Lactococcus phage phiLC3
Q9ZXH8    181 vTTSPNYNYFPSYDNIGIFQFTSTYKAGGLDGDiDLTGITDNG 223 Oenococcus phage fOg44
Q9ZEK6     63 --PIAEADFFISVVKNYIGK-----AVLVLDFEaGAINAWGNV 98  Lactococcus lactis
NP_958600 172 -TNTADFNYFPSMEGVIIWQFTDNWRGMNVDGNiNLLELETKK 213 Lactobacillus prophage Lj965
P19385    158 --GTANFEYFPSMDGIRWWQYSSNPF----DKNiVLlddeked 194 Streptococcus phage CP-7
P33486     71 -RAKKEAAYFLKEAKK---QDISKKRMLWLDWEaGSGNVVTGS 109 Lactobacillus phage mv1
1OBA_A    158 --GTANFEYFPSMDGIRWWQYSSNPF----DKNiVLLDDEEDd 194 Streptococcus phage Cp-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap