Conserved Protein Domain Family
FTP

?
smart00607: FTP 
eel-Fucolectin Tachylectin-4 Pentaxrin-1 Domain
Statistics
?
PSSM-Id: 128870
View PSSM: smart00607
Aligned: 10 rows
Threshold Bit Score: 202.402
Threshold Setting Gi: 74871592
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9I931   29 QENVAVRGKATQSTLPSGAGAVLSLPGFAIDGNRDSDFSHG-SCSHTTNSpNPWWRVDLLQLYTITSVTITNRGDCCGER 107  Japanese eel
Q9I928   31 EENVALRGRATQSAQLRGEHAALAHASNAIDGNRDSNYHHG-SCTHTEGA-NPWWRVDLLQVYTIASVTITNRGDCCGER 108  Japanese eel
Q9VYR4  113 GVNVAYRKPVNQSSYTRSGP-----ASYANDGKPGNKNPDGqECSETQKEpSPWWRVDLLTPQAVHVVRITTRGCCGHQP 187  fruit fly
P49263   37 AKNVAPQGIPYQSSY----YGQKEQAKRVIDGSLASNYMEG-DCCHTEKQmHPWWQLDMKSKMRVHSVAITNRGDCCRER 111  African clawed frog
Q9I927   40 QENVAVRGKATQSALASGGGAVLSLPGYAIDGNRDSDSSHG-SCSHTTNGpNPWWRVDLLQVYTIASVTITNRGDCCGER 118  Japanese eel
Q9I926   40 QENVAVRGKATQSDQLQGQWDAFSHASNAIDGNQDSYFYHG-SCTHTSGGaNPWWRVDLLQEYKITSVTITNRGDCCGER 118  Japanese eel
Q9I925   40 QENVALRGRATQSAQLRGDHSGIAHASNAIDGNRDSVFYHG-SCTHTEAD-KPWWRVDLLQVYTITSVTITNRGDCCEER 117  Japanese eel
Q9I929   31 QENVALRGRATQSAQLKGEFAGFAHASNAIDGNRDSNYHHG-SCSHTEGD-NSWWRVDLKQVYTITSVTITNRGDCCGER 108  Japanese eel
Q9I930   31 QENVALRGRATQSAQLRGEHAGISHASNAIDGNRDSYFYHG-SCSHTEGD-NPLWRVDLLQVYTITSVTITNRGDCCGER 108  Japanese eel
Q9VXX7   94 LNVAAGKAPMQISTDGAGA-P----QKAIDGSTSAFFTPET-CSLTKAERsPWWYVNLLEPYMVQLVRLDFGKSCCGNKP 167  fruit fly
Q9I931  108 ISGARILIGNSLENNGINNPACSVIGSMETGETRTFHCPQPMIGRYVTVYLPK-T-EVLQLCEVE--VNALLPVN 178  Japanese eel
Q9I928  109 ISGARILIGNSLENNGINNPQCSVIGSLATGETRTFHCPQPMIGRYVTVYLPK-I-ESLQLCEVE--VNALLPVN 179  Japanese eel
Q9VYR4  188 LQDLEIRVGNSSADLQRNPLCAWYPGTLDEGVVKTFTCARPLVGQYVAIQLVG-VeGSLSLCEVEtfTNDEFSVD 261  fruit fly
P49263  112 INGAEIRIGNSKKEGGLNSTRCGVVFKMNYEETLSFNCKE-LEGRYVTVTIPD-RiEYLTLCEVQ--VFA-DPLE 181  African clawed frog
Q9I927  119 ITGAHILIGNSLENNGINNPQCSTVGIMTAGETRTFHCSRPMIGRYVTVYLPK-T-EYLQLCEVE--VNALLPAN 189  Japanese eel
Q9I926  119 ITGARIIIG---KNNGLNNPECSTVGIMTAGETKTFRCSHPMIGRYVTVYLPK-T-EYLHLCEVE--VNAMLPAN 186  Japanese eel
Q9I925  118 ISGARILIGKHLENNGINNPQCSVIGPMAAGETKTFRCPQPMIGRYVTVYLPK-A-ESLHLCEVE--VNVLFPAP 188  Japanese eel
Q9I929  109 ISGARILIGKHLENNGINNPECSTINIMAAGETKTFHCPQPMIGRYVTVYLPK-A-ESLQLCEVE--VNVLFPAP 179  Japanese eel
Q9I930  109 ISGARILIGKHLENNGINNPECSTINIMAAGETRTFHCPQPMIGRYVTVYLPK-T-GTLHLCEVE--VNVLFPAP 179  Japanese eel
Q9VXX7  168 ATIVVRVGNNRPDLGTNPICNRFTGLLEAGQPLFLPCNPPMPGAFVSVHLENStPnPLSICEAFVytDQALPIER 242  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap