2YUE


Conserved Protein Domain Family
NEUZ

?
smart00588: NEUZ 
Click on image for an interactive view with Cn3D
domain in neuralized proteins
Statistics
?
PSSM-Id: 128856
View PSSM: smart00588
Aligned: 14 rows
Threshold Bit Score: 153.62
Threshold Setting Gi: 24762732
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2YUE_A       7 GPLQFH-SVHGDNIRISRDGTLA--RR--F--ES-FCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTL 78   fruit fly
T16028     455 RPLRFH-YVKGCHITLNPSRNIA--TR--D--QAeYSQGYVFTERPIKNNEKVMIMISQVQRLYEGGLAFGVTCCDPASI 527  nematode
NP_476652  367 IPVPFH-NTKGRNVRLSQDRFVA--SR--T--ESdFCQGYVFTARPIRIGEKLIVQVLKTEQMYVGALALGLTSCNPAML 439  fruit fly
ABB36465   464 DRLTFH-HICGTHATVTQSGRTA--LR--PnaADdFNNGVVLTRRPLRPNELFQVRLERVVTKWAGSVEMGVTTHSADEL 538  fruit fly
ABB36465   653 VPLRFH-SIHGANAGISNSGLTA--SRpnS--LAeFNDAIVFSNRPLRQRELFEVELETMVRHWSGNIEIGVTGTRPEDI 727  fruit fly
NP_648688    5 EAQSFH-TRCGRSIRLYNNNRMA--QR--S--MRdFSHALVFSAEPLEDDVLFEVVIEKKNTYWGGSIEIGVTAESPDDL 77   fruit fly
CAB65238   292 GDLRFHaLRRRAHVRILDEQTVA--RV--E--HGrDERALVFTSRPLRVAETIFIKVTRSGGARPGALSFGVTTCDPGTL 365  house mouse
CAI13958    44 TPLLFHpHTKGSQILMDLSHKAV--KR--Q--AS-FCNAITFSNRPVLIYEQVRLKITKKQCCWSGALRLGFTSKDPSRI 116  human
EAW49629   275 GDLRFHaLRAGAHVRILDEQTVA--RV--E--HGrDERALVFTSRPVRVAETIFVKVTRSGGARPGALSFGVTTCDPGTL 348  human
ABB36465   221 DRLCFH-TRCGSLVKLSPNFRSAerRR--P--LDeFNNGVVMTHRPLRDNELFEIRIDKLVDKWSGSIEVGVTTHNPAVL 295  fruit fly
2YUE_A      79 E-GTLPKYACPDLTNRPGFWAKALHEQYC-EKDNILYYYVNGAGDVIYGIN 127  fruit fly
T16028     528 RvAGLP-DDSSDLVEMPEYWVGIKDIALQpKANSILSFWITDSGEVKFEID 577  nematode
NP_476652  440 QpNDLP-NDSDFLLDRPEYWVVSKDIAAApQRGDEIAFFVAPNGEVSISKN 489  fruit fly
ABB36465   539 DfPFTMTNVRSGTWMMTGNGVMQNGVTVI-EQYG-QNLDRLQVGDRVGVVR 587  fruit fly
ABB36465   728 QlAPNATDLEASDTIILCGPMIFHNRKTI-RTNILLDLDTLGPSTRVGVMR 777  fruit fly
NP_648688   78 ElVACATAMRNGTWVMSGIDVRKDGRRLF-EFYGT-DLETLNENDRVGVMR 126  fruit fly
CAB65238   366 RpADLP-FSPEALVDRKEFWAVCRVPGPL-HSGDILGLVVNADGELHLSHN 414  house mouse
CAI13958   117 HpDSLPKYACPDLVSQSGFWAKALPEEFA-NEGNIIAFWVDKKGRVFHRIN 166  human
EAW49629   349 RpADLP-FSPEALVDRKEFWAVCRVPGPL-HSGDILGLVVNADGELHLSHN 397  human
ABB36465   296 HfPATMTNMRSGTIMMSGCGILTNGKGTR-RQYGEFNLDELREGDRVGMMR 345  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap