Conserved Protein Domain Family
ZnF_DBF

?
smart00586: ZnF_DBF 
Zinc finger in DBF-like proteins
Statistics
?
PSSM-Id: 128854
View PSSM: smart00586
Aligned: 7 rows
Threshold Bit Score: 84.0669
Threshold Setting Gi: 7304903
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAD01519  590 RDPKPGYCENCRDKFDDFDEHIMTRKHRKFAANSANWAELDSLLFQLER 638 Emericella nidulans
NP_588105 492 VDAKPGYCENCREKFDNFESHIRSSRHRRFAENNDNFKDLDELFALVQR 540 Schizosaccharomyces pombe 972h-
NP_596287 421 IETKSGYCENCCERYKDLERHLGGKHHRRFAEKDENFQGLDDLFLLIRR 469 Schizosaccharomyces pombe 972h-
CAA42819  645 TVKNSGYCENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLRF 693 baker's yeast
NP_038754 288 EKRKKGYCECCLQKYEDLETHLLSEKHRNFAQSN-QYQVVDDIVSQLVF 335 house mouse
BAE21148  287 EKRKKGYCECCLQKYEDLETHLLSEKHRNFAQSN-QYQVVDDIVSQLVF 334 house mouse
AAM50251  307 SEKQGGVCEICKLEYDILNIHLQSKDHELFAKNSDNFLALDTLIQSSAD 355 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap