Conserved Protein Domain Family
DZF

?
smart00572: DZF 
domain in DSRM or ZnF_C2H2 domain containing proteins
Statistics
?
PSSM-Id: 128842
View PSSM: smart00572
Aligned: 10 rows
Threshold Bit Score: 342.048
Threshold Setting Gi: 17563154
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_868130      69 TLRGVMRVGLVAKGLLLKGDLDLELVLLCKEKPTTALLDKVADNLAIQLAAVT-----EDkyeil---qsvdD------- 133  dog
AAC25762      762 ALKGVLRVGVLAKGLLLRGDRNVNLVLLCSEKPSKSLLSRIAENLPKQLAVIS-----PEkydik---cavsE------- 826  house mouse
Q9JKU6         81 TLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLT-----EEkyqve---qcinE------- 145  Norway rat
NP_001083930   88 TLRGVMRVGLVAKGLLLKGDLDLELVLLCRDKPTISLLKRVADNLVLQFETVS-----EDkyevi---qnirE------- 152  African clawe...
NP_055989     652 VLKGVMRVGILAKGLLLRGDRNVRLALLCSEKPTHSLLRRIAQQLPRQLQMVT-----ED------------Eyevssdp 714  human
NP_788510     577 ILKGVMRVGYLAKGLLLHGDNAVELVVLCAEKPTSGLLQRVANVLPDKLKEVA-----GDtqvnyrvevnaeE------- 644  fruit fly
NP_650196      99 QLEEVRQVGSFKKGTILTGNNVADVVVILKTLPTKEAVDALAKKVEADLKASM-----KT------------E------- 154  fruit fly
AAA20993       98 QIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQD-----PS------------E------- 153  human
NP_506614      86 GIATISHVGSFVTDTTTHSSDKSDVVVQLSTLPSYETVAELGRKVVENMKIAD-----PK------------E------- 141  nematode
ADY18587      481 TVLGCSRVGIIAKGTFIKGDRCAEVVLTCTPVPTSGLVEQIRRLFGESTTSLTiepdpES------------P------- 541  nematode
XP_868130     134 -AAIVIKNTKEPPLSLTIHLTSPVVREEMEKVLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANGL-----KSC 207  dog
AAC25762      827 -AAIILNSCVEPKMQVTITLTSPIIREENMREGDVTSGMVKDPPDVLDRQKCLDALAALRHAKWFQARANGL-----QSC 900  house mouse
Q9JKU6        146 -ASIIIRNTKEPTLTLKVILHSPLIRDELEKK-DGENVMMKDPPDLLDRQKCLNALASLRHAKWFQARANGL-----KSC 218  Norway rat
NP_001083930  153 -ALIVVKSTKEPPLTLNIRLTSPLVREEMEKLSAGETLTVSDPPDVLDRHKCLAALASLRHAKWFQARANGL-----KSC 226  African clawe...
NP_055989     715 eANIVISSCEEPRMQVTISVTSPLMREDPSTDPGVEE-PQADAGDVLSPKKCLESLAALRHARWFQARASGL-----QPC 788  human
NP_788510     645 -AALIVLDESV---SVKITLTSPLLRDANPGEAATTDEGEGDSE-FLPREPCLRALADLRHAKWFQARATGL-----QSC 714  fruit fly
NP_650196     155 -VLTKGDQHTVQIHERGFDIANVHAKVRILIATLPQNLRKLEPEIHLDHKLMQSHLAAIRHTRWFEENAHHS------SI 227  fruit fly
AAA20993      154 -VLT------MLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQS------TV 220  human
NP_506614     142 -TGEP------LQMEYGCLITSHNCQVRLLITIIPEESTKLEPLLHLDSKQMMINFFSTRHITWFSQISSELppafiQEW 214  nematode
ADY18587      542 -SSLIVTANYFPNMKCRILITS---------AVVRKDDDSIVTGCAADKDLCIYALASIRNTKWYDSHCQYL-----NSC 606  nematode
XP_868130     208 VIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSI--G--TANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKEATDA 283  dog
AAC25762      901 VIIIRILRDLCQRVPTWSDFPSWAMELLVEKAI--S--SASSPQSPGDALRRVFECISSGIILKGSPGLLDPCEKDPFDT 976  house mouse
Q9JKU6        219 VIVLRILRDLCNRVPTWAPLKGWPLELICEKSI--G--TCNRPLGXGEALRRVMECLASGILLPGGPGLHDPCERDPTDA 294  Norway rat
NP_001083930  227 VIVIRVLRDLCTRVPTWEPLRGWPLELLCEKAI--G--TANRPMGAGEALRRVLECLSSGILMPDGSGLYDPCEKDASDA 302  African clawe...
NP_055989     789 VIVIRVLRDLCRRVPTWGALPAWAMELLVEKAV--S--SAAGPLGPGDAVRRVLECVATGTLLTDGPGLQDPCERDQTDA 864  human
NP_788510     715 VMVIRILRDLCQRVSSWQSLPQWSLELLVEKVI--S--SAGFPISPGDCMRRIMEALSSGFLIN-GPGLLDPCEKDPTDA 789  fruit fly
NP_650196     228 KVLIRILKDLTRRFDAFSPLSAWMLDLIAHLAI--MnnPSRQALPINLAFRRVFQLLSAGLFLPGSAGITDPTEPGHIRV 305  fruit fly
AAA20993      221 KVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAV--MnnPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRV 298  human
NP_506614     215 QALVRVLKDTRSRYSDFQPLSIWTIQYLAFYCLanG--PNRQKACLGTAFRRFFEIIAAGIFLPKSPCLIDPVS-ANYRI 291  nematode
ADY18587      607 QSVIRLLRDLRNKYPEVACLDDYKMELIVSNII--D--SSPMSLGLSDAFKRIVEALASGYLY--SAILSDPCETSRPNV 680  nematode
XP_868130     284 IGHLDRQQREDITQSAQHALRLAAFG--QLHKVLGMDPLPSK 323  dog
AAC25762      977 LATMTDQQREDITSSAQKALRLLAFR--QIHKVLGMDPLPQM 1016 house mouse
Q9JKU6        295 LSYMTTQQKEDITHSAQHALRLSAFG--QIYKVLEMDPLPSS 334  Norway rat
NP_001083930  303 LEHLERQQREDITQSAQHALRLAAFG--QLHKVLGMDPLPSK 342  African clawed frog
NP_055989     865 LEPMTLQEREDVTASAQHALRMLAFR--QTHKVLGMDLLPPR 904  human
NP_788510     790 LLELTKQEREDLTVSAQLFLRYIAFR--QIYKVLGMEPLPAM 829  fruit fly
NP_650196     306 HTAMTLEQQDVCCYTSQTLLRVLAHG--GYKHILGLEGNTSV 345  fruit fly
AAA20993      299 HTVMTLEQQDMVCYTAQTLVRILSHG--GFRKILGQEGDASY 338  human
NP_506614     292 GFDLTLPQMDTVCMGAQTLVRIFATGndGYRAILGTHGTAAD 333  nematode
ADY18587      681 LDALTDEQKHSLTALAQNFVRQIAFN--QIHEILGIDRLQDT 720  nematode
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap