Conserved Protein Domain Family
GIT

?
smart00555: GIT 
Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins
Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins, and in yeast Spa2p and Sph1p (CPP; unpublished results). In p95-APP1 the N-terminal GIT motif might be involved in binding PIX.
Statistics
?
PSSM-Id: 128828
View PSSM: smart00555
Aligned: 14 rows
Threshold Bit Score: 39.0674
Threshold Setting Gi: 18203659
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O42869         82 ARQKLSSLAPTRLRDLCMDVFFEVQSRYSGA 112  Schizosaccharomyces pombe 972h-
Q9Z272        337 GRQKLARFNAREFATLIIDILSEAKRRQQGK 367  Norway rat
Q19467        326 RRQKLAKFTPIQFTILLIDLIKDQKRRITGD 356  Caenorhabditis elegans
O13526         43 RNKDLTKLSNVQFWQLTTDVNDELMKRLTDS 73   baker's yeast
Q9Z272        273 AKKKLQALSNRLFEELAMDVYDEVDRRENDA 303  Norway rat
Q19467        264 SRAAISVLPKGQFFDLCEDAFDETVRRENEV 294  Caenorhabditis elegans
O13526         89 AQSKLSRLKDAKFHKLILDIFTEIERRNLHH 119  baker's yeast
NP_013079     336 KNLKINYTIDESFQKELLSLNSQIGELSIEN 366  Saccharomyces cerevisiae S288c
XP_001976187  314 ARGKLQLVPNKMFEELVMDLYDEVDRRECEA 344  Drosophila erecta
CAY81217       94 ARQKLANLSQTRFNDLLDDILFEIKRRGFDK 124  Saccharomyces cerevisiae EC1118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap