Conserved Protein Domain Family

smart00555: GIT 
Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins
Helical motif in the GIT family of ADP-ribosylation factor GTPase-activating proteins, and in yeast Spa2p and Sph1p (CPP; unpublished results). In p95-APP1 the N-terminal GIT motif might be involved in binding PIX.
PSSM-Id: 128828
Aligned: 14 rows
Threshold Bit Score: 39.0674
Threshold Setting Gi: 18203659
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O42869         82 ARQKLSSLAPTRLRDLCMDVFFEVQSRYSGA 112  Schizosaccharomyces pombe 972h-
Q19467        326 RRQKLAKFTPIQFTILLIDLIKDQKRRITGD 356  Caenorhabditis elegans
O13526         43 RNKDLTKLSNVQFWQLTTDVNDELMKRLTDS 73   baker's yeast
Q19467        264 SRAAISVLPKGQFFDLCEDAFDETVRRENEV 294  Caenorhabditis elegans
O13526         89 AQSKLSRLKDAKFHKLILDIFTEIERRNLHH 119  baker's yeast
NP_013079     336 KNLKINYTIDESFQKELLSLNSQIGELSIEN 366  Saccharomyces cerevisiae S288c
XP_001976187  314 ARGKLQLVPNKMFEELVMDLYDEVDRRECEA 344  Drosophila erecta
CAY81217       94 ARQKLANLSQTRFNDLLDDILFEIKRRGFDK 124  Saccharomyces cerevisiae EC1118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap