Conserved Protein Domain Family

smart00541: FYRN 
Click on image for an interactive view with Cn3D
FY-rich domain, N-terminal region
is sometimes closely juxtaposed with the C-terminal region (FYRC), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
PSSM-Id: 128814
Aligned: 17 rows
Threshold Bit Score: 57.2936
Threshold Setting Gi: 7485978
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
T24864         2149 ITPKQLKRFHTKDYIFPNNYRITRLFWSPKSHRERMMF--ECIIED 2192 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap