2WZO


Conserved Protein Domain Family
FYRN

?
smart00541: FYRN 
Click on image for an interactive view with Cn3D
FY-rich domain, N-terminal region
is sometimes closely juxtaposed with the C-terminal region (FYRC), but sometimes is far distant. Unknown function, but occurs frequently in chromatin-associated proteins.
Statistics
?
PSSM-Id: 128814
View PSSM: smart00541
Aligned: 17 rows
Threshold Bit Score: 57.2936
Threshold Setting Gi: 7485978
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WZO_A           19 EIITDRPGFHDESAIYPVGYCSTRIYASMKCPDQKCLY--TCQIKD 62   human
T00470          643 GFLVVGKLWCNKHAIFPKGFKSRVKFYNVQDPMRISYYv-SEIVDA 687  thale cress
AAD32935        611 GFLIFGKLWCNKYAIFPKGFRSRVKFYNVLDPTRMSNYi-SEVLDA 655  thale cress
TIGR:At2g31650  393 KVVTDSQFFKDENHIWPEGYTAMRKFTSLTDHSASALYk-MEVLRD 437  thale cress
T24864         2149 ITPKQLKRFHTKDYIFPNNYRITRLFWSPKSHRERMMF--ECIIED 2192 Caenorhabditis elegans
T10582          647 VHGITDKSAVTDVKLGVGGFKSRVKFLSVLDPTNLTNYi-SEVLDA 691  thale cress
AAF56387        122 EIISVNPNFHTESWIYPVGYVATRIYAHPKDPRKKCVF--TCKILN 165  Drosophila melanogaster
XP_002188579   1894 CLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVY--TCKIME 1937 zebra finch
XP_001112093   1861 sLGTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWY--RCRILE 1904 rhesus monkey
XP_002054789   1890 LGSIVPRFSDSFEAIVPINFLCSRLYWSSKEPWKIVEYtvRTTIQN 1935 Drosophila virilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap