Conserved Protein Domain Family
LEM

?
smart00540: LEM 
in nuclear membrane-associated proteins
LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
Statistics
?
Aligned: 13 rows
Threshold Bit Score: 46.9429
Threshold Setting Gi: 6981660
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
T22115            426 RKIRRLREGELKSELKKFGISPaGPLDARTRRLYEKKLLIERRKI 470 Caenorhabditis elegans
NP_031953           2 DDYAVLSDTELAAVLRQYNIPH-GPIVGSTRKLYEKKIFEYETQR 45  house mouse
NP_037019         109 LDVTELSNEELLEQLVRYGVNP-GPIVGTTRKLYEKKLLKLREQG 152 Norway rat
AAC05382           92 PDVTELSNEALKEELLKYGMKP-GPILSNTRKLYEQRLLKLREQG 135 African clawed frog
AAD31594            8 AAPQQLSDEELFSQLRRYGLSP-GPVTESTRPVYLKKLKKLREEE 51  house mouse
T26067              2 VDVEKMSDAELRAELNVRGANV-GPVTGTTRSLYEKKLKKLLSGG 45  Caenorhabditis elegans
T15287              1 MDVSQLTDAELRDSLKSHGVSV-GPIVATTRKLYEKKLIKLSDGS 44  Caenorhabditis elegans
FlyBase:CG8679-PA 404 TLPLDYETDALRRELTQLGAPV-GPITKTTKRLYIKQLIKYKRNT 447 fruit fly
ABY20424           14 QDIQRLTDAQLSTMCKSHGLIL-GPITFQNRRMAERKLHIAMITE 57  fruit fly
XP_002082905        4 ESLNSLSDKELHRKLIQSGFPS-TPVTETTRAVLIEKLRKHTRAD 47  Drosophila simulans
XP_002091949        5 DDFDSLSNAELRAKMLAQGLPN-IPVTDSSRKVLVKRLRASIGGQ 48  Drosophila yakuba
NP_001014611        5 SYLDTLGNKELLAKCLEHGLPG-VPVTDSTRSVIIRRLKAKITGV 48  fruit fly
XP_003128394        1 --MAGLSDLELRRELQALGFQP-GPITDTTRDVYRNKLRRLRGEA 42  pig
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap