Conserved Protein Domain Family

smart00540: LEM 
in nuclear membrane-associated proteins
LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
PSSM-Id: 128813
View PSSM: smart00540
Aligned: 13 rows
Threshold Bit Score: 46.9429
Threshold Setting Gi: 6981660
Created: 12-Jul-2011
Updated: 2-Oct-2020
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
T22115            426 RKIRRLREGELKSELKKFGISPaGPLDARTRRLYEKKLLIERRKI 470 Caenorhabditis elegans
T26067              2 VDVEKMSDAELRAELNVRGANV-GPVTGTTRSLYEKKLKKLLSGG 45  Caenorhabditis elegans
T15287              1 MDVSQLTDAELRDSLKSHGVSV-GPIVATTRKLYEKKLIKLSDGS 44  Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap