Conserved Protein Domain Family
LEM

?
smart00540: LEM 
in nuclear membrane-associated proteins
LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
Statistics
?
PSSM-Id: 128813
View PSSM: smart00540
Aligned: 13 rows
Threshold Bit Score: 46.9429
Threshold Setting Gi: 6981660
Created: 12-Jul-2011
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40
                 ....*....|....*....|....*....|....*....|....*
gi 7503290   426 RKIRRLREGELKSELKKFGISPaGPLDARTRRLYEKKLLIERRKI 470
gi 6679641     2 DDYAVLSDTELAAVLRQYNIPH-GPIVGSTRKLYEKKIFEYETQR 45
gi 6981660   109 LDVTELSNEELLEQLVRYGVNP-GPIVGTTRKLYEKKLLKLREQG 152
gi 2947303    92 PDVTELSNEALKEELLKYGMKP-GPILSNTRKLYEQRLLKLREQG 135
gi 4883638     8 AAPQQLSDEELFSQLRRYGLSP-GPVTESTRPVYLKKLKKLREEE 51
gi 7508784     2 VDVEKMSDAELRAELNVRGANV-GPVTGTTRSLYEKKLKKLLSGG 45
gi 7505873     1 MDVSQLTDAELRDSLKSHGVSV-GPIVATTRKLYEKKLIKLSDGS 44
gi 7298771   404 TLPLDYETDALRRELTQLGAPV-GPITKTTKRLYIKQLIKYKRNT 447
gi 162944710  14 QDIQRLTDAQLSTMCKSHGLIL-GPITFQNRRMAERKLHIAMITE 57
gi 195586279   4 ESLNSLSDKELHRKLIQSGFPS-TPVTETTRAVLIEKLRKHTRAD 47
gi 195487538   5 DDFDSLSNAELRAKMLAQGLPN-IPVTDSSRKVLVKRLRASIGGQ 48
gi 62472454    5 SYLDTLGNKELLAKCLEHGLPG-VPVTDSTRSVIIRRLKAKITGV 48
gi 311260258   1 --MAGLSDLELRRELQALGFQP-GPITDTTRDVYRNKLRRLRGEA 42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap