1KCF


Conserved Protein Domain Family
SAP

?
smart00513: SAP 
Click on image for an interactive view with Cn3D
Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation
Statistics
?
PSSM-Id: 128789
View PSSM: smart00513
Aligned: 43 rows
Threshold Bit Score: 38.2364
Threshold Setting Gi: 75219736
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1KCF_A       1 MATVKLSFLQHICKLTGLSRSGRKDELLRRIVDSP 35   fission yeast
O94451      18 ETGLIIPQLKDILRVFGLRLSGTKAELITRIKQLI 52   Schizosaccharomyces pombe 972h-
O44406      92 MDTMTAEQLKQALMKIKVSTGGNKKTLRKRVAQYY 126  Caenorhabditis elegans
CAA21935   287 FSSLSTQKIKAKLSDLKLPTTGSRNEMEARYLHYY 321  Candida albicans
CAA65152     7 LNDFSLTTLKDWLRILGQNTEGTKTELIARLQDIP 41   fruit fly
EGA87770   278 FTSMTQSQIKQKLSSLGLSTNGTRQNMIKRYNHYE 312  Saccharomyces cerevisiae VL3
NP_595423  240 YALLSESKIRSKLSEMGLPTDGHKQLLQRRHAKWV 274  Schizosaccharomyces pombe 972h-
BAA02015   256 YSIVRDTALRKKLSELGLSTHGSRQLLEKRHKEWI 290  Neurospora crassa
Q02398     236 YSLLKDTVLRKKLKDLGIPNWGPRALLQRRHTEWL 270  Emericella nidulans
AAF19193   248 YNLLSDRDLKKKLKQYGLSVPGNKQQLIKRHQEFV 282  house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap