3PO3,2DME


Conserved Protein Domain Family
TFS2M

?
smart00510: TFS2M 
Click on image for an interactive view with Cn3D
Domain in the central regions of transcription elongation factor S-II (and elsewhere)
Statistics
?
PSSM-Id: 128786
View PSSM: smart00510
Aligned: 18 rows
Threshold Bit Score: 95.8429
Threshold Setting Gi: 7267856
Created: 12-Jul-2011
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3PO3_S         15 HKLRDQVLKALYDVLAKESEHPp-----------QSIL-------------HTAKAIESEMNKVN-------N---CDTN 60   baker's yeast
Q9Y7V2        215 NPVRKSVAKAWVSVFEKIIEKAkleg----vqglEDLN-------------STSLALQLEHIMFMvlsyttdH---SLTP 274  Schizosacchar...
EAW75324      708 QNIRRSLKEILWKRVNDSDDLIm-----------TENE-------------VGKIALHIEKEMFN-------L---FQVT 753  human
NP_193607     119 DKVREILQTSLAKVASEVVDTEmkt-------rvTACD-------------PWVVAVSVETAMFE-------N---LGCF 168  thale cress
BAD43128      290 EFTVNCQNEMIGAMANDGSLEK------------LLLD-------------PQVLAFEIETELFK-------L---FGGV 334  thale cress
XP_002690024  921 QSVRHSLKDILMKRLTDSNLKVp-----------EE-K-------------AAKVATKIEKELFS-------F---FRDT 965  cattle
EDZ72168       79 HKLRDQVLKALYDVLAKESEHPp-----------QSIL-------------HTAKAIESEMNKVN-------N---CDTN 124  Saccharomyces...
NP_593623     131 DKIRNNCIGLMYNALVIDSDESss---------lIIAK-------------AKEIDAQVLARA-------------AGKT 175  Schizosacchar...
AAC60551      146 HKLRYNAEKMFSTLFSKFIVPEt-----------IEAKlyelpdgkdvisiSQEFAHNLEEELYKacl--nvE---FGTL 209  baker's yeast
CAB78199      428 DAHRDKCLGKLLEAVQHICYIPenkqagdeakdeKFLW-------------PDAAVPQVCALENA-------ShasLASD 487  thale cress
3PO3_S         61 EAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEE 116  baker's yeast
Q9Y7V2        275 NNKYREKFRALRFNLVDDKNPAFRARVLKNEISFNDLVNLSSEEMANPDLKNLAEE 330  Schizosaccharomyces pombe 972h-
EAW75324      754 DNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKER 809  human
NP_193607     169 MGPQKAKYRSILFNMGDSNNPDLRRKVLLGEISGERLVKMEKEEMGSSWYTNSRRN 224  thale cress
BAD43128      335 NKKYKEKGRSLLFNLKDKSNPKLREKVMYGEIAAERLCSMSAEELASKELAEWRQA 390  thale cress
XP_002690024  966 DAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKELAAWRRR 1021 cattle
EDZ72168      125 EAAYKARYRIIYSNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEE 180  Saccharomyces cerevisiae AWRI1631
NP_593623     176 GSEYRNRMRSLYMNLKDKNNPKLRASVLRNEITPQRLSTMTSAELASEDRRKEDAK 231  Schizosaccharomyces pombe 972h-
AAC60551      210 DKIYTEKVRSLYSNLKDKKNLELKAHVVEGKLPLNKLVNMNASELANPDLQEFKEK 265  baker's yeast
CAB78199      488 FQKYNQKMRTLVFNLK--NTALLARRLLNGELEPATILNMSPTEL-KEGLTADETT 540  thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap